Search by BoMiProt ID - Bomi7915


Primary Information

BoMiProt ID Bomi7915
Protein Name PHD finger protein 10/BRG1-associated factor 45a/BAF45a
Organism Bos taurus
Uniprot IdQ2T9V9
Milk Fractionwhey
Ref Sequence Id NP_001033141.1
Aminoacid Length 410
Molecular Weight 46437
Fasta Sequence https://www.uniprot.org/uniprot/Q2T9V9.fasta
Gene Name PHF10/BAF45A
Gene Id 507648
Protein Existence Status Reviewed

Secondary Information

Protein Function Involved in transcription activity regulation by chromatin remodeling
Biochemical Properties PHF10 is a subunit of the signature module of PBAF, responsible for its interaction with chromatin.Two of PHF10 isoforms lacking C-terminal PHD domains contain a cluster of phosphorylated serine residues, designated as X-cluster.The X-cluster consists of two independently phosphorylated subclusters. Phosphorylation of the second subcluster depends on phosphorylation of a primary serine 327. These two subclusters surround a sequence, which is predicted to be a nuclear localization sequence (NLS3). The NLS3 does not affect localization of PHF10 isoforms.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2T9V9|PHF10_BOVIN PHD finger protein 10 OS=Bos taurus OX=9913 GN=PHF10 PE=2 SV=1 MLQEQVSEYLGVTSFKRKYPDLERRDLSHKEKLYLRELNVITETQCTLGLTALRSDEVID LMIKEYPAKHAEYSVILQEKERQRITDHYKEYSQMQQQNTQKVEASKVPEYIKKAAKKAA EFNSNLNRERMEERRAYFDLQTHVIQVPQGKYKVLPTERTKVSSYPVALIPGQFQEYYKR YS*182PDELRYLPLNTALYEPPLDPELPALES*209DGDS*219DDAEDGRGDEKGKSKGTSDS*329SSGNVSEGEGLPEGQEEPLPGRQRPRDKAAAPRKDAPKRSALSKAVPGHKPKVIPNALCGICLKGKE SSRRGKAEPLVHCSQCDNSGHPSCLDMTMELVSMIKTYPWQCMECKTCIICGQPHHEEEM MFCDVCDRGYHTFCVGLGAIPSGRWICDCCQRAPPTPRKVGRRGKNSKEG
Predicted Disorder Regions 88-111, 183-309, 398-410
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs The X-cluster consists of two independently phosphorylated sub-clusters that surround a potential nuclear localization signal (NLS3). The first sub-cluster contains two primary phosphorylated serines 297 and 301. The second sub-cluster includes the primary phosphorylated serine 327, its phosphorylation triggers phosphorylation of serines 331, as well as serines 323 and 335, which were also found to be phosphorylated.The sequential phosphorylation of PHF10 subunit of the PBAF chromatin-remodeling complex determines different properties of the PHF10 isoforms.
Bibliography 1.Sheynov, A. A., Tatarskiy, V. V., Jr, Tatarskiy, E. V., Nabirochkina, E. N., Georgieva, S. G., & Soshnikova, N. V. (2020). The sequential phosphorylation of PHF10 subunit of the PBAF chromatin-remodeling complex determines different properties of the PHF10 isoforms. Biology open, 9(1), bio043943. https://doi.org/10.1242/bio.043943 2.Anbunathan, H., Verstraten, R., Singh, A. D., Harbour, J. W., & Bowcock, A. M. (2019). Integrative Copy Number Analysis of Uveal Melanoma Reveals Novel Candidate Genes Involved in Tumorigenesis Including a Tumor Suppressor Role for PHF10/BAF45a. Clinical cancer research : an official journal of the American Association for Cancer Research, 25(16), 5156–5166. https://doi.org/10.1158/1078-0432.CCR-18-3052