Search by BoMiProt ID - Bomi7910


Primary Information

BoMiProt ID Bomi7910
Protein Name PH and SEC7 domain-containing protein 1/Exchange factor for ADP-ribosylation factor guanine nucleotide factor 6/Exchange factor for ARF6/Exchange factor for ARF6 A/Pleckstrin homology and SEC7 domain-containing protein 1
Organism Bos taurus
Uniprot IdF1MUS9
Milk Fractionwhey
Ref Sequence Id NP_001178404.1
Aminoacid Length 1026
Molecular Weight 109765
Fasta Sequence https://www.uniprot.org/uniprot/F1MUS9.fasta
Gene Name PSD
Gene Id 523124
Protein Existence Status Reviewed

Secondary Information

Protein Function It is a guanine nucleotide exchange factor for ARF6. Involved in cytoskeletal remodeling.Also regulates the membrane trafficking of small G proteins.PSD can regulate Rac1 which plays a pivotal role in inducing apoptosis in response to stimuli such as UV light, tumor necrosis factor-α and Fas.
Biochemical Properties The 5′-end of the PSD gene contains five CpG islands, suggesting that its expression may be controlled by epigenetic modification.
PTMs Phsophorylation via CaMKII pathway
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|F1MUS9|PSD1_BOVIN PH and SEC7 domain-containing protein 1 OS=Bos taurus OX=9913 GN=PSD PE=2 SV=1 MAQGAMRFCSEGDCAISPPRCPRRWLPEGPVPQSPPASMYGSTGSLLRRVAGPGPRSREL GRVTAPCTPLRGPPSPRIAPSPWAPSSPTGQPPPGARSSVVIFRFVEKASVRPLNGLPAP GGLSRS*126WDLGGVSPPRPTPALGPGSHQKLRLEASTS*156DPLPAGGGSARPGTQGLLQGPPTQ PQVGADGLYSSLPNGLGGPSEHLATLFRGPADTGLLNQGDIWSSPREVSSHAQRIARAKW EFFYGSLDPPSSGAKPPEQAPPSPPGVGSGQGSGVAVGRAAKYSETDLDTVPLRCYRETD IDEVLTEREEADSAIESQPSSEGLPGTARPPAPRPGPCLGPHPSLGSGNEDEDEAGGEED VDDEVFEASEGARPGTRMPHSGPLKSPLPFLPGTSPSADGPDSFSCVFEAILESHRAKGT SYTSLASLEALASPGPTQSPFFTFELPPQPPAPRPDPPAPAPLAPLEPDSGTSSAADGPW TQRGEEEEAEAGAKQTPGRDPPSPCHSEDSFGLGAAPLGSEPPLNQLVSDSDSELDSTER LALGSTDTLSNGQKADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFF VFTGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPGALSSEDGAHTLTCALM LLNTDLHGHNIAETHDLRRLHRYLEGLNEGGDFPRELLKALYSSIKNEKLQWAIDEEELR RS*722LSELADPNPKVIKRVSGGSGSGSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPR GKRGWKNFHGILKGMILYLQKEEYQPGKALSEAELKNAISIHHALATRASDYSKRPHVFY LRTADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPAAVSSQKKFSRPLLPSAATRL SQEEQVRTHEAKLKAMASELREHRATQLTKKARGKEAEEQRQKEAYLEFEKSRYGTYAAL LRVKLKAGSEELDAVEAAVAQAGGTEDGLPPPHSSPSLPANTSSQPRAQCSDSEARAGAG SGRWKP
Predicted Disorder Regions 283-407, 441-532, 996-1024
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments PSD gene may function as a tumor suppressor in gastric cancer suggesting a vital role for DNA methylation and histone modification in PSD silencing.
Bibliography 1.Zhu X, Liu J, Xu X, Zhang C, Dai D. The Pleckstrin and Sec7 domain-containing gene as a novel epigenetic modification marker in human gastric cancer and its clinical significance. Int J Oncol. 2015 Jan;46(1):195-204. doi: 10.3892/ijo.2014.2736. Epub 2014 Oct 30. Erratum in: Int J Oncol. 2022 Mar;60(3): PMID: 25355626. 2.Murphy, J. A., Jensen, O. N., & Walikonis, R. S. (2006). BRAG1, a Sec7 domain-containing protein, is a component of the postsynaptic density of excitatory synapses. Brain research, 1120(1), 35–45. https://doi.org/10.1016/j.brainres.2006.08.096