Search by BoMiProt ID - Bomi7897


Primary Information

BoMiProt ID Bomi7897
Protein Name Peripherin
Organism Bos taurus
Uniprot IdA6QQJ3
Milk FractionWhey
Ref Sequence Id NP_001095848.1
Aminoacid Length 469
Molecular Weight 53631
Fasta Sequence https://www.uniprot.org/uniprot/A6QQJ3.fasta
Gene Name PRPH
Gene Id 510082
Protein Existence Status reviewed

Secondary Information

Protein Function An intermediate filament present in peripheral and certain central nervous system neurons.Potential role during nerve growth factor (NGF)-promoted neuronal differentiation.
Biochemical Properties Each subunit consists of a central alpha helical rod domain flanked by nonhelical N and C terminal domains.
PTMs Phosphorylation,Nitration
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QQJ3|PERI_BOVIN Peripherin OS=Bos taurus OX=9913 GN=PRPH PE=2 SV=1 MSHPSGLRSSVSSTSYRRTFGPPPSLS*27PGAFSYSSSSRFSSSRLLGSAS*49PGSSVRLGS*58FR GPRAGTGALLRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQQ NAALRGELNQARGQEPARADQLCQQELRELRRELELLGRERDRVQVERDGLAEDLAALKQ RLEEETRKREDAEHNLVLFRKDVDDATLSRLELERKIESLMDEIEFLKKLHEEELRDLQL SVESQQVQHVEVEATVKPELTAALRDIRAQYESIAAKNLQEAEEWYKSKYADLSDAANRN HEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALEAGGYQAGAARL EEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLSIKT TVPEVEPPQETHSRKMVLIRTIETRDGEQVVTESQKEQHSELDKSPQSY*469
Predicted Disorder Regions 1-30, 56-59, 141-143, 418-428, 454-469
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Peripherin is phosphorylated on Tyrosine-474 in rat has a role in modulating interaction with other proteins.Function of intermediate filament phosphorylation may reside in defining regional localizations within neurons. For example, nonphosphorylated neurofilaments arefound in somata and dendrites, while phosphoforms are more prevalent in axons.Phosphorylation increases after nerve injury in regenerating neurons.
Bibliography 1.Aletta JM, Shelanski ML, Greene LA. Phosphorylation of the peripherin 58-kDa neuronal intermediate filament protein. Regulation by nerve growth factor and other agents. J Biol Chem. 1989 Mar 15;264(8):4619-27. PMID: 2538451. 2.Angelastro JM, Ho CL, Frappier T, Liem RK, Greene LA. Peripherin is tyrosine-phosphorylated at its carboxyl-terminal tyrosine. J Neurochem. 1998 Feb;70(2):540-9. doi: 10.1046/j.1471-4159.1998.70020540.x. PMID: 9453548.