Primary Information |
|---|
| BoMiProt ID | Bomi7882 |
|---|
| Protein Name | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1/Peptidyl-prolyl cis-trans isomerase Pin1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q5BIN5 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001029804.1 |
|---|
| Aminoacid Length | 163 |
|---|
| Molecular Weight | 18273 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | PIN1 |
|---|
| Gene ID | 535470 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | pons |
|---|
| Protein Function | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (Pin1) has been frequently overexpressed in many types of malignancy, suggesting its oncogenic function. It recognizes phosphorylated serine or threonine (pSer/Thr) of a target protein and isomerizes the adjacent proline (Pro) residue, thereby altering folding, subcellular localization, stability, and function of target proteins. |
|---|
| Biochemical Properties | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (Pin1) belongs to a member of parvulin subfamily.It consists of an N-terminal WW domain and terminal peptide prolyl cis/trans isomerases (PPIase) domain. |
|---|
| PTMs | N6-acetylation at Lysine,Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q5BIN5|PIN1_BOVIN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Bos taurus OX=9913 GN=PIN1 PE=2 SV=1
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSGSGKNGQGEPTRVRCSHL
LVKHSQSRRPS*71SWRQEKITRTKEEALELINGYIQKIKSGEEDFESLAS*108QFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|---|
| Predicted Disorder Regions | 1-87, 112-133 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylation at Ser-71 by DAPK1 results in inhibition of its catalytic activity, nuclear localization, and its ability to induce centrosome amplification, chromosome instability and cell transformation |
|---|
| Bibliography | 1.Saeidi S, Kim SJ, Guillen-Quispe YN, Jagadeesh ASV, Han HJ, Kim SH, Zhong X, Piao JY, Kim SJ, Jeong J, Shin YJ, Cha YJ, Lee HB, Han W, Min SH, Tian W, Kitamura H, Surh YJ. Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 directly binds and stabilizes Nrf2 in breast cancer. FASEB J. 2022 Jan;36(1):e22068. doi: 10.1096/fj.202100776RR. PMID: 34918396. |