Search by BoMiProt ID - Bomi7882


Primary Information

BoMiProt ID Bomi7882
Protein Name Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1/Peptidyl-prolyl cis-trans isomerase Pin1
Organism Bos taurus
Uniprot IdQ5BIN5
Milk FractionExosomes
Ref Sequence Id NP_001029804.1
Aminoacid Length 163
Molecular Weight 18273
Fasta Sequence https://www.uniprot.org/uniprot/Q5BIN5.fasta
Gene Name PIN1
Gene Id 535470
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells pons
Protein Function Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (Pin1) has been frequently overexpressed in many types of malignancy, suggesting its oncogenic function. It recognizes phosphorylated serine or threonine (pSer/Thr) of a target protein and isomerizes the adjacent proline (Pro) residue, thereby altering folding, subcellular localization, stability, and function of target proteins. 
Biochemical Properties Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (Pin1) belongs to a member of parvulin subfamily.It consists of an N-terminal WW domain and terminal peptide prolyl cis/trans isomerases (PPIase) domain.
PTMs N6-acetylation at Lysine,Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5BIN5|PIN1_BOVIN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Bos taurus OX=9913 GN=PIN1 PE=2 SV=1 MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSGSGKNGQGEPTRVRCSHL LVKHSQSRRPS*71SWRQEKITRTKEEALELINGYIQKIKSGEEDFESLAS*108QFSDCSSAKARG DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Predicted Disorder Regions 1-87, 112-133
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation at Ser-71 by DAPK1 results in inhibition of its catalytic activity, nuclear localization, and its ability to induce centrosome amplification, chromosome instability and cell transformation
Bibliography 1.Saeidi S, Kim SJ, Guillen-Quispe YN, Jagadeesh ASV, Han HJ, Kim SH, Zhong X, Piao JY, Kim SJ, Jeong J, Shin YJ, Cha YJ, Lee HB, Han W, Min SH, Tian W, Kitamura H, Surh YJ. Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 directly binds and stabilizes Nrf2 in breast cancer. FASEB J. 2022 Jan;36(1):e22068. doi: 10.1096/fj.202100776RR. PMID: 34918396.