Search by BoMiProt ID - Bomi7880


Primary Information

BoMiProt ID Bomi7880
Protein Name Peptidyl-prolyl cis-trans isomerase FKBP3/25 kDa FK506-binding protein/FK506-binding protein 3
Organism Bos taurus
Uniprot IdP26884
Milk FractionExosomes
Ref Sequence Id NP_001033201.1
Aminoacid Length 224
Molecular Weight 25191
Fasta Sequence https://www.uniprot.org/uniprot/P26884.fasta
Gene Name FKBP3
Gene Id 515069
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells gluteus medius
Protein Function FKBP3, which is located in the nucleus, is a partner of p53-regulating protein MDM2, regulates p53 and p21 expression, and is associated with histone deacetylases (HDAC) activity.
Biochemical Properties FKBP3 (also known as FKBP25) is a member of FK506-binding proteins (FKBPs), which express peptidylprolyl cis-trans-isomerase (PPIase) activity and bind immunosuppressant drugs such as FK506 and rapamycin.
PTMs N6-acetylation at Lysine,Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P26884|FKBP3_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Bos taurus OX=9913 GN=FKBP3 PE=1 SV=2 MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQDHGSDS*36FLAEHKLLGNIKNVAKTANKDHLV TAYNHLFESKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGD KTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTS*152SKKKKNAKPLSFKVGIGKVIRGWDEALL TMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLIFEVELVDID
Predicted Disorder Regions 1-15, 76-86, 93-99, 116-125, 150-163, 198-205
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1. Jin YJ, Burakoff SJ, Bierer BE. Molecular cloning of a 25-kDa high affinity rapamycin binding protein, FKBP25. J Biol Chem. 1992;267:10942–5. 2.Zhu W, Li Z, Xiong L, Yu X, Chen X, Lin Q. FKBP3 Promotes Proliferation of Non-Small Cell Lung Cancer Cells through Regulating Sp1/HDAC2/p27. Theranostics. 2017 Jul 22;7(12):3078-3089. doi: 10.7150/thno.18067. PMID: 28839465; PMCID: PMC5566107.