Primary Information |
---|
BoMiProt ID | Bomi7880 |
---|
Protein Name | Peptidyl-prolyl cis-trans isomerase FKBP3/25 kDa FK506-binding protein/FK506-binding protein 3 |
---|
Organism | Bos taurus |
---|
Uniprot ID | P26884 |
---|
Milk Fraction | Exosomes |
---|
Ref Sequence ID | NP_001033201.1 |
---|
Aminoacid Length | 224 |
---|
Molecular Weight | 25191 |
---|
FASTA Sequence |
Download |
---|
Gene Name | FKBP3 |
---|
Gene ID | 515069 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | gluteus medius |
---|
Protein Function | FKBP3, which is located in the nucleus, is a partner of p53-regulating protein MDM2, regulates p53 and p21 expression, and is associated with histone deacetylases (HDAC) activity. |
---|
Biochemical Properties | FKBP3 (also known as FKBP25) is a member of FK506-binding proteins (FKBPs), which express peptidylprolyl cis-trans-isomerase (PPIase) activity and bind immunosuppressant drugs such as FK506 and rapamycin. |
---|
PTMs | N6-acetylation at Lysine,Phosphorylation at Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P26884|FKBP3_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Bos taurus OX=9913 GN=FKBP3 PE=1 SV=2
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQDHGSDS*36FLAEHKLLGNIKNVAKTANKDHLV
TAYNHLFESKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGD
KTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTS*152SKKKKNAKPLSFKVGIGKVIRGWDEALL
TMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLIFEVELVDID
|
---|
Predicted Disorder Regions | 1-15, 76-86, 93-99, 116-125, 150-163, 198-205 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Bibliography | 1. Jin YJ, Burakoff SJ, Bierer BE. Molecular cloning of a 25-kDa high affinity rapamycin binding protein, FKBP25. J Biol Chem. 1992;267:10942–5. 2.Zhu W, Li Z, Xiong L, Yu X, Chen X, Lin Q. FKBP3 Promotes Proliferation of Non-Small Cell Lung Cancer Cells through Regulating Sp1/HDAC2/p27. Theranostics. 2017 Jul 22;7(12):3078-3089. doi: 10.7150/thno.18067. PMID: 28839465; PMCID: PMC5566107. |