Search by BoMiProt ID - Bomi7873


Primary Information

BoMiProt ID Bomi7873
Protein Name Peptidase inhibitor 16(PI-16)/CD_antigen: CD364
Organism Bos taurus
Uniprot IdQ58D34
Milk FractionWhey
Ref Sequence Id NP_001019658.1
Aminoacid Length 464
Molecular Weight 49327
Fasta Sequence https://www.uniprot.org/uniprot/Q58D34.fasta
Gene Name PI16
Gene Id 507058
Protein Existence Status reviewed

Secondary Information

Protein Function is a membrane-tethered regulator of chemerin processing in the myocardium.A member of the CAP family of proteins which we found to be highly upregulated in cardiac disease.
PTMs glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q58D34|PI16_BOVIN Peptidase inhibitor 16 OS=Bos taurus OX=9913 GN=PI16 PE=2 SV=1 MHGSGSLLACLLPPLLLLGAAPGPAGALSEEEKHVMVELHNLYRTQVSPPATNMLQMRWD EELAAFAKAYAQQCVWGHNKERGRRGENLFAITGEGLDVPLAMEEWHHERLEHYN*114SAISC AAGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIHLLVCNYEPPGNVKGQRPYQEG TPCSQCPLGYHCKNSLCEPIRGPEEAQDLSSLVPEAPSSLATEASSSRREGIDSSLATEP PPFLVTEVSGSLATKVLSSVETKAPSSLVTEDSPSMATKTPLSLATKVPSVLATHSLLSL DKRPATLLPKSTHDPIPKSADKEASSTRMPSRIPESSLHPKISLMGTREPLPLSQEEGEA EAELAHCSEILASVFPAQEKPGELQTTLKHKGHSSSKSLSNSPSASATANAVGGRTLALQ SSLPDAEGPGKHGFRSGSNASPGHVGGLLLGLLLLLPLVLAGIF
Predicted Disorder Regions 2 disordered segments; (214-412), (421-441)
DisProt Annotation
TM Helix Prediction 1TMH; (445-463)
Significance of PTMs N glycosylated
Bibliography Regn M, Laggerbauer B, Jentzsch C, Ramanujam D, Ahles A, Sichler S, Calzada-Wack J, Koenen RR, Braun A, Nieswandt B, Engelhardt S. Peptidase inhibitor 16 is a membrane-tethered regulator of chemerin processing in the myocardium. J Mol Cell Cardiol. 2016 Oct;99:57-64. doi: 10.1016/j.yjmcc.2016.08.010. Epub 2016 Aug 15. PMID: 27539859.