Search by BoMiProt ID - Bomi7833


Primary Information

BoMiProt ID Bomi7833
Protein Name Parvalbumin alpha
Organism Bos taurus
Uniprot IdQ0VCG3
Milk FractionWhey
Ref Sequence Id NP_001069582.1
Aminoacid Length 110
Molecular Weight 12082
Fasta Sequence https://www.uniprot.org/uniprot/Q0VCG3.fasta
Gene Name PVALB
Gene Id 538603
Protein Existence Status reviewed

Secondary Information

Protein Function involved in relaxation after contraction. EF-hand type proteins.During nervous system development, its expression accompanies the maturation of functional circuits.
Biochemical Properties It binds two calcium ions .beta parvalbumin differs in 54 positions from alpha parvalbumin and lacks the C-terminal amino acid 109.
Significance in milk Calcium binding properties
PTMs Acetylation on Ser, Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0VCG3|PRVA_BOVIN Parvalbumin alpha OS=Bos taurus OX=9913 GN=PVALB PE=3 SV=3 MS*2MTDLLHAEDIKKAVGAFTAVDS*24FDHKKFFQMVGLKKKSPEDVKKVFHILDKDKSGFIE EEELGFILKGFSPDARDLSVKETKTLLAAGDKDGDGKIGADEFSTLVAES
Predicted Disorder Regions 3 disordered segments; (1-4), (33-83), (90-95)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Vologzhannikova AA, Shevelyova MP, Kazakov AS, Sokolov AS, Borisova NI, Permyakov EA, Kircheva N, Nikolova V, Dudev T, Permyakov SE. Strontium Binding to α-Parvalbumin, a Canonical Calcium-Binding Protein of the "EF-Hand" Family. Biomolecules. 2021 Aug 5;11(8):1158. doi: 10.3390/biom11081158. PMID: 34439824; PMCID: PMC8392015.