Search by BoMiProt ID - Bomi7828


Primary Information

BoMiProt ID Bomi7828
Protein Name Paraspeckle component 1
Organism Bos taurus
Uniprot IdQ1LZD9
Milk FractionWhey
Ref Sequence Id NP_001068745.1
Aminoacid Length 520
Molecular Weight 58275
Fasta Sequence https://www.uniprot.org/uniprot/Q1LZD9.fasta
Gene Name PSPC1
Gene Id 506696
Protein Existence Status reviewed

Secondary Information

Protein Function cellular stress responses, cell differentiation, corpus luteum formation and cancer progression.androgen receptor co-activator.detected in differentiating Sertoli cell nuclei from day 15 onwards, as they develop androgen responsiveness.
PTMs Acetylation on Met, Methylation on Arg, Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1LZD9|PSPC1_BOVIN Paraspeckle component 1 OS=Bos taurus OX=9913 GN=PSPC1 PE=2 SV=1 MMLRGNLKQVRIEKNPARLRALESAAGEGDPAALALALPGEPPVPAAPAGEDRPADEGGF TIDIKSFLKPGEKTYTQRCRLFVGNLPTDITEDDFKRLFERYGEPSEVFINRDRGFGFIR LESRTLAEIAKAELDGTILKSRPLRIRFATHGAALTVKNLSPVVSNELLEQAFSQFGPVE KAVVVVDDRGRATGKGFVEFAAKPPARKALERCGDGAFLLTTTPRPVIVEPMEQFDDEDG LPEKLMQKTQQYHKEREQPPRFAQPGTFEFEYASRWKALDEMEKQQREQVDRNIREAKEK LEAEMEAARHEHQLMLMRQDLMRRQEELRRLEELRNQELQKRKQIQLRHEEEHRRREEEM IRHREQEELRRQQEGFKPNYMENREQEMRMGDMGPRGAINMGDAFS*406PAPAGNQGPPAMMG MNMNNRGTIPGPPMGPGPAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPS*470QMGS*474PMGSRT GSETPQAPMSGVGPVSGGPGGFGRGS*506QGANFEGPNKRRRY
Predicted Disorder Regions 2 disordered segments; (32-56), (368-373)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Hupalowska A, Jedrusik A, Zhu M, Bedford MT, Glover DM, Zernicka-Goetz M. CARM1 and Paraspeckles Regulate Pre-implantation Mouse Embryo Development. Cell. 2018 Dec 13;175(7):1902-1916.e13. doi: 10.1016/j.cell.2018.11.027. PMID: 30550788; PMCID: PMC6292842.