Search by BoMiProt ID - Bomi7804


Primary Information

BoMiProt ID Bomi7804
Protein Name Palmitoyltransferase ZDHHC5/Zinc finger DHHC domain-containing protein 5/DHHC-5
Organism Bos taurus
Uniprot IdE1BLT8
Milk Fractionwhey
Ref Sequence Id NP_001179692.1
Aminoacid Length 714
Molecular Weight 76976
Fasta Sequence https://www.uniprot.org/uniprot/E1BLT8.fasta
Gene Name ZDHHC5
Gene Id 533250
Protein Existence Status Reviewed

Secondary Information

Protein Function Palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates and is involved in a variety of cellular processes. Palmitoylates the G-protein coupled receptor SSTR5 and for FLOT2
Biochemical Properties It also has an extended C-terminal tail, which contains many PTMs including phosphorylation and palmitoylation, with a PDZ-binding ligand at the extreme C terminus of the protein, through which it could interact with PDZ domain-containing substrates and regulators.
PTMs Phosphorylation and Methylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|E1BLT8|ZDHC5_BOVIN Palmitoyltransferase ZDHHC5 OS=Bos taurus OX=9913 GN=ZDHHC5 PE=3 SV=1 MPAESAKRFKPSKYVPVSAAAIFLVGATTLFFAFTCPGLSLSVSPAVPVYNAVVFLFVLA NFSMATFMDPGVFPRAEEDEDKEDDFRAPLY*91KTVEIKGIQVRMKWCATCRFYRPPRCSHC SVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHITGVFGFGLLYVLYHMEELSG VRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNV SRVLCSS*247PAPRYLGRPKKEKTIVIRPPFLRPEVSDGQITVKIMDNGIQGELRRT*294KS*296KGS*299LEVT*303ESQSADAEPPPPPKPDLSRYTGLRTHLSLATNEESSLLGKDS*345PPT*348PT*350MYKYRPGYSSSSASAAMPHSSSAKLSRGDS*380LKEPPSIAESSRQPSYRS*398EPSLEPES*406FRS*409PT*411LGKGFPFDPLSSGS*425RSSS*429LKS*432AQGT*436GFELGPLQSIRSEGTTSTSYKSLANQTRNGSLSYDSLLTPSDSPDFESVQAGPEPEPPLGYTSPFLSARLAQQREAERHPRLAPGGPAPREPS*529PVRYDNLSRHI VASLQEREKLLRQS*554PPPGREEEPGLGDSGVQCTPGSGHAPRTSSSSDDSKRSPLGKTPLA RPVAPRFGKPDGLRGRGLAS*620PEPGLPAPYLGRSVSYSSQKAPPGVPETEEVALQPLLT*658PK DEVQLKTAYSKSNGQPKSIGSAPPGPGQPPLSS*693PTRGGVKKVSGVGGTTYEISV
Predicted Disorder Regions 339-409, 429-521, 535-659,672-709
DisProt Annotation
TM Helix Prediction 4TMHs; (13-35),(47-65), (148-170), (189-211)
Bibliography Zimin, A. V., Delcher, A. L., Florea, L., Kelley, D. R., Schatz, M. C., Puiu, D., Hanrahan, F., Pertea, G., Van Tassell, C. P., Sonstegard, T. S., Marçais, G., Roberts, M., Subramanian, P., Yorke, J. A., & Salzberg, S. L. (2009). A whole-genome assembly of the domestic cow, Bos taurus. Genome biology, 10(4), R42. https://doi.org/10.1186/gb-2009-10-4-r42