Search by BoMiProt ID - Bomi7756


Primary Information

BoMiProt ID Bomi7756
Protein Name Osteopontin-K
Organism Bos taurus
Uniprot IdP31098
Milk FractionWhey
Aminoacid Length 277
Molecular Weight 30969
Fasta Sequence https://www.uniprot.org/uniprot/P31098.fasta
Gene Name N/A
Protein Existence Status Reviewed

Secondary Information

Protein Function Involved in cell adhesion
Biochemical Properties The N-terminal amino acid region of pBk2.1 ,which cDNA of bovine renal osteopontin-k,(the first 82 amino acids) and 42 amino acids at the C terminus had the highest level of homology with the osteopontins at 86%. The middle portion of the peptide had greatly reduced homology, ranging from 50% (amino acids 83–174) to 12% (amino acids 175–219).
PTMs Glycosylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P31098|OSTK_BOVIN Osteopontin-K OS=Bos taurus OX=9913 PE=2 SV=1 MRIAVICFCLLGIASALPVKPTS*23S*24GS*26S*27EEKQLNNKYPDAVATWLKPDPSQKQTFLAPQNS*60 VS*62S*63EETDDNKQNTLPS*76KS*78NEDPEQTDDLDDDDDNS*95QDVNS*100N*101DS*103DDAETTDDPDHS*115DESHHSDES*124HQVHFPTDIPTIAVFTPFIPTESANDGRGDRCGLRTEVKIIEVPPINVQSPDAT*178EEDFTS*184HIES*188ERCMSTKKTSRLTDHS*204KETNRCELSKELMPKAKDKNKHSNLIES*232QENSKLS*239QEFHS*244LEDKLDLDHKS*255EEDKHLKIRIS*266HELDS*271AS*273SEVN
Predicted Disorder Regions 1-277
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs It has a potential glycosylation site (Asn-X-Ser/Thr) which is responsible for binding to GRGDS receptor.
Bibliography Crivello JF, Delvin E. Isolation and characterization of a cDNA for osteopontin-k: a kidney cell adhesion molecule with high homology to osteopontins. J Bone Miner Res. 1992 Jun;7(6):693-9. doi: 10.1002/jbmr.5650070614. PMID: 1414488.