Primary Information |
---|
BoMiProt ID | Bomi7756 |
---|
Protein Name | Osteopontin-K |
---|
Organism | Bos taurus |
---|
Uniprot Id | P31098 |
---|
Milk Fraction | Whey |
---|
Aminoacid Length | 277 |
---|
Molecular Weight | 30969 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/P31098.fasta |
---|
Gene Name | N/A |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Protein Function | Involved in cell adhesion |
---|
Biochemical Properties | The N-terminal amino acid region of pBk2.1 ,which cDNA of bovine renal osteopontin-k,(the first 82 amino acids) and 42 amino acids at the C terminus had the highest level of homology with the osteopontins at 86%. The middle portion of the peptide had greatly reduced homology, ranging from 50% (amino acids 83–174) to 12% (amino acids 175–219). |
---|
PTMs | Glycosylation, Phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P31098|OSTK_BOVIN Osteopontin-K OS=Bos taurus OX=9913 PE=2 SV=1
MRIAVICFCLLGIASALPVKPTS*23S*24GS*26S*27EEKQLNNKYPDAVATWLKPDPSQKQTFLAPQNS*60
VS*62S*63EETDDNKQNTLPS*76KS*78NEDPEQTDDLDDDDDNS*95QDVNS*100N*101DS*103DDAETTDDPDHS*115DESHHSDES*124HQVHFPTDIPTIAVFTPFIPTESANDGRGDRCGLRTEVKIIEVPPINVQSPDAT*178EEDFTS*184HIES*188ERCMSTKKTSRLTDHS*204KETNRCELSKELMPKAKDKNKHSNLIES*232QENSKLS*239QEFHS*244LEDKLDLDHKS*255EEDKHLKIRIS*266HELDS*271AS*273SEVN
|
---|
Predicted Disorder Regions | 1-277 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | It has a potential glycosylation site (Asn-X-Ser/Thr) which is responsible for binding to GRGDS receptor. |
---|
Bibliography | Crivello JF, Delvin E. Isolation and characterization of a cDNA for osteopontin-k: a kidney cell adhesion molecule with high homology to osteopontins. J Bone Miner Res. 1992 Jun;7(6):693-9. doi: 10.1002/jbmr.5650070614. PMID: 1414488. |