Search by BoMiProt ID - Bomi7752


Primary Information

BoMiProt ID Bomi7752
Protein Name Origin recognition complex subunit 6
Organism Bos taurus
Uniprot IdQ2HJF3
Milk FractionWhey
Ref Sequence Id NP_001039666.1
Aminoacid Length 252
Molecular Weight 28080
Fasta Sequence https://www.uniprot.org/uniprot/Q2HJF3.fasta
Gene Name ORC6/ORC6L
Gene Id 515476
Protein Existence Status Reviewed

Secondary Information

Protein Function nucleates DNA replication initiation in eukaryotic cells.ORC complex is sequentially assembled at the exit from anaphase of mitosis and disassembled as cells enter S phase.This six-protein complex binds replication origin DNA, recruits other initiation factors, and facilitates loading of the DNA helicase.
PTMs phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2HJF3|ORC6_BOVIN Origin recognition complex subunit 6 OS=Bos taurus OX=9913 GN=ORC6 PE=2 SV=1 MESGLIRRLAPRLGIAEQEVLRKAEEYLRLSRVKCVGLSARTTETSNAVMCLDLAASCMK CPLDRAYLIKLSGLNKKMYQSCLKSFECLLGLNSNIGIRDLAVQFSCTEAVNLASKILQS YESSLPQTQQVDLDLSRPLFTTAALLSACKILKLKVDRNKMAATSGVKKAIFDRLCKQLE KIGQQIDREAGDSVT*195PPQKKKKTVIEPSAKEIENVVETLPKPQKDEDLT*229QDYEEWKRNIL ENAARAQKAATQ
Predicted Disorder Regions 1-18, 153-171, 185-252
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs To prevent DNA re-replication Ser-116 site on ORC6 is phosphorylated by CDK.Ser-116 phosphorylation inhibits the nuclear import of ORC6.As long as it is phosphorylated ,it prevents binding of another helicase to ORC.
Bibliography 1.Chen S, de Vries MA, Bell SP. Orc6 is required for dynamic recruitment of Cdt1 during repeated Mcm2-7 loading. Genes Dev. 2007 Nov 15;21(22):2897-907. doi: 10.1101/gad.1596807. PMID: 18006685; PMCID: PMC2049192.2.Lin JR, Liu Z, Hu J. Computational identification of post-translational modification-based nuclear import regulations by characterizing nuclear localization signal-import receptor interaction. Proteins. 2014 Oct;82(10):2783-96. doi: 10.1002/prot.24642. Epub 2014 Jul 31. PMID: 25043850.