Primary Information |
---|
BoMiProt ID | Bomi7752 |
---|
Protein Name | Origin recognition complex subunit 6 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q2HJF3 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001039666.1 |
---|
Aminoacid Length | 252 |
---|
Molecular Weight | 28080 |
---|
FASTA Sequence |
Download |
---|
Gene Name | ORC6/ORC6L |
---|
Gene ID | 515476 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Protein Function | nucleates DNA replication initiation in eukaryotic cells.ORC complex is sequentially assembled at the exit from anaphase of mitosis and disassembled as cells enter S phase.This six-protein complex binds replication origin DNA, recruits other initiation factors, and facilitates loading of the DNA helicase. |
---|
PTMs | phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2HJF3|ORC6_BOVIN Origin recognition complex subunit 6 OS=Bos taurus OX=9913 GN=ORC6 PE=2 SV=1
MESGLIRRLAPRLGIAEQEVLRKAEEYLRLSRVKCVGLSARTTETSNAVMCLDLAASCMK
CPLDRAYLIKLSGLNKKMYQSCLKSFECLLGLNSNIGIRDLAVQFSCTEAVNLASKILQS
YESSLPQTQQVDLDLSRPLFTTAALLSACKILKLKVDRNKMAATSGVKKAIFDRLCKQLE
KIGQQIDREAGDSVT*195PPQKKKKTVIEPSAKEIENVVETLPKPQKDEDLT*229QDYEEWKRNIL
ENAARAQKAATQ
|
---|
Predicted Disorder Regions | 1-18, 153-171, 185-252 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | To prevent DNA re-replication Ser-116 site on ORC6 is phosphorylated by CDK.Ser-116 phosphorylation inhibits the nuclear import of ORC6.As long as it is phosphorylated ,it prevents binding of another helicase to ORC. |
---|
Bibliography | 1.Chen S, de Vries MA, Bell SP. Orc6 is required for dynamic recruitment of Cdt1 during repeated Mcm2-7 loading. Genes Dev. 2007 Nov 15;21(22):2897-907. doi: 10.1101/gad.1596807. PMID: 18006685; PMCID: PMC2049192.2.Lin JR, Liu Z, Hu J. Computational identification of post-translational modification-based nuclear import regulations by characterizing nuclear localization signal-import receptor interaction. Proteins. 2014 Oct;82(10):2783-96. doi: 10.1002/prot.24642. Epub 2014 Jul 31. PMID: 25043850. |