Search by BoMiProt ID - Bomi7750


Primary Information

BoMiProt ID Bomi7750
Protein Name Origin recognition complex subunit 1
Organism Bos taurus
Uniprot IdQ58DC8
Milk FractionWhey
Ref Sequence Id NP_001014918.1
Aminoacid Length 863
Molecular Weight 97902
Fasta Sequence https://www.uniprot.org/uniprot/Q58DC8.fasta
Gene Name ORC1/ORC1L
Gene Id 513523
Protein Existence Status reviewed

Secondary Information

Protein Function regulates cell growth and metastasis in glioma by altering activation of ERK and JNK signaling pathway
Biochemical Properties Origin recognition complex (ORC), a heteromeric six-subunit complex, is the central component of the eukaryotic pre-replication complex. ORC1 primarily regulated the cell cycle and affects apoptotic signaling pathways.
PTMs Phosphorylation at Ser/Thr,Acetylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q58DC8|ORC1_BOVIN Origin recognition complex subunit 1 OS=Bos taurus OX=9913 GN=ORC1 PE=2 SV=2 MAYYSARLRTRQTYSWVGRPLLDQKLHYQTYKEMSMKREDYSTEIHIQVGQFVLIEGDDD ENPYVAKLVELFEDDSELYSKKRARVQWFIRFCEVPVCKQHLLGRKPGTQEIFWYDNPTC NSNISVETIIGSVRVVALAPDEVMPIDLKNKKTFFVKLSWNEKKFKPLPPEVFAQLNKLQ EDNHRYQKPMQAKTKSAES*199PSWT*203TTEHAVKRIESRHSTSKSRHTASHPVTPRARKRLELS SFPRTPNTRISPAAS*255CAS*258LDSPGRMKRKVAFSEVMS*276PSKRSLPDGFQTSS*290PALKAPEKTGEIQHSCTKDAKKTSPDHGMILRARAPALKITETSEERTLT*340PIGGGRKSSVVPSVILKPEY IKRREGKEPEVQDEAPSTSRIRRKSSVLTLNRIRQQLRFLGNSKSDENDEEFLPAAEIS*419D CDSEEEEASTTPLPRRTPNSVSRNLRSSMKSSLQTPSKTPKKTPEPRTPRDATPRIRSRN LTAQGPTNMLEEARLRLHVAAVPESLPCREQEFQDIYNFVESKLLDQTGGCMYISGVPGT GKTATVHEVICCLQQAAQANEVPPFQYIEVNGMKLTEPHQVYVQILQKLTGKRATANHAA ALLAKRFCTQGSSQETTVLLVDELDLLWTQKQDVMYNLFDWPTHKEARLVVLTIANTMDL PERIMMNRVSSRLGLTRMCFQPYTHSQLRQILLSRLRHVKAFEDDAIQLVARKVAALSGD ARRCLDICRRATEICEFSCQKPDSPGLVTTAHLLEAIDEMFSSSYITAIKNSSVLEQSFL RAILAEFRRSGLEEATFQQVYIQHVALCRMEGLPYPTMSETMAVCSRLGACRLLLVEPSR NDVLRRVRLNVSQDDVLYALKEE
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Acetylation and Glycosylation U64
Additional Comments OCR1 inhibition reduced invasion and migration, promoted cell apoptosis. In addition, OCR1 overexpression promoted cell proliferation and induced G2 phase arrest. Moreover, OCR1 downregulation suppressed activation of the ERK/JNK signaling pathway. 
Bibliography 1.Xiong W, Xie C, Qiu Y, Tu Z, Gong Q. Origin recognition complex subunit 1 regulates cell growth and metastasis in glioma by altering activation of ERK and JNK signaling pathway. Mol Cell Probes. 2020 Feb;49:101496. doi: 10.1016/j.mcp.2019.101496. Epub 2019 Dec 20. PMID: 31866342. 2.Popova VV, Brechalov AV, Georgieva SG, Kopytova DV. Nonreplicative functions of the origin recognition complex. Nucleus. 2018;9(1):460-473. doi: 10.1080/19491034.2018.1516484. PMID: 30196754; PMCID: PMC6244734.