Search by BoMiProt ID - Bomi7742


Primary Information

BoMiProt ID Bomi7742
Protein Name Oncoprotein-induced transcript 3 protein
Organism Bos taurus
Uniprot IdQ29RU2
Milk FractionWhey
Ref Sequence Id NP_001039529.1
Aminoacid Length 547
Molecular Weight 60550
Fasta Sequence uniprot.org/uniprot/Q29RU2.fasta
Gene Name OIT3
Gene Id 510915
Protein Existence Status reviewed

Secondary Information

Protein Function OIT3 deficiency impairs uric acid reabsorption in renal tubule.it may also act as a potential therapeutic agent in hyperuricemia and renal dysfunction.
Biochemical Properties The oncoprotein induced transcript 3 (OIT3), also named liver-specific zona pellucida domain-containing protein (LZP), has been shown to be expressed in kidney, and was confirmed to interact with the Tamm-Horsfall glycoprotein (THP).
PTMs N-linked Glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q29RU2|OIT3_BOVIN Oncoprotein-induced transcript 3 protein OS=Bos taurus OX=9913 GN=OIT3 PE=2 SV=1 MPQLLLLACLLIIVTRVAPRALDPCSAYISLNEPWRNTEHQFDESRGSPLCDNSVDGEWY RFTGMAGDAMPTFCIPENHCGTHAPVWLN*89GSHPLEGDGIVQRQACASFNGNCCLWN*116TTVE VKSCPGGYYVYRLTKPSVCFHVYCGHFYDICDDDCHGSCLGTSECTCAPGTVLGPDRQTC FDENECEQNNGGCSEICVNLKNSYRCECGIGRVLRSDGKTCEDIEGCHNNNGGCSHSCLT SETGYQCECPRGLVLSEDNHTCQVPVFCKSNTIEVSIPRDLVGGLELFLTNTSCRGVSN*299G THVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKQTPGSSGDIIIRTSKLLIPVTCEFPR LYTISEGYVPNLRNTPLEIMSRSHGIFPFTLEIFKDHEFEEPYREALPTLKLRDSLYFGI EPLVHVNGLESLVESCFATPTSKIDEIMKYYIIQDGCVSDDSVKQYTSRDHLAKHFQVPV FKFVGKDHKEVFLHCRVLVCGMLDERSRCAQGCHRRVRREASTEGEDASGPRSQMLTGGP ISIDWED
Predicted Disorder Regions 521-547
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Hypouricemic and Nephroprotective Effects of Emodinol in Oxonate-Induced Hyperuricemic Mice are Mediated by Organic Ion Transporters and OIT3
Bibliography 1.Hui W, Yongliang Y, Yongde C, Guo L, Li L, Zhonglin Y, Hui J, Qinghua H. Hypouricemic and Nephroprotective Effects of Emodinol in Oxonate-Induced Hyperuricemic Mice are Mediated by Organic Ion Transporters and OIT3. Planta Med. 2016 Mar;82(4):289-297. doi: 10.1055/s-0035-1558212. Epub 2015 Nov 19. PMID: 26584455. 2.Hui W, Yongliang Y, Yongde C, Guo L, Li L, Zhonglin Y, Hui J, Qinghua H. Hypouricemic and Nephroprotective Effects of Emodinol in Oxonate-Induced Hyperuricemic Mice are Mediated by Organic Ion Transporters and OIT3. Planta Med. 2016 Mar;82(4):289-297. doi: 10.1055/s-0035-1558212. Epub 2015 Nov 19. PMID: 26584455.