Search by BoMiProt ID - Bomi7739


Primary Information

BoMiProt ID Bomi7739
Protein Name Oligoribonuclease, mitochondrial/RNA exonuclease 2 homolog/Small fragment nuclease
Organism Bos taurus
Uniprot IdA2VE52
Milk FractionWhey
Ref Sequence Id NP_001075204.1
Aminoacid Length 237
Molecular Weight 26885
Fasta Sequence https://www.uniprot.org/uniprot/A2VE52.fasta
Gene Name REXO2
Gene Id 540139
Protein Existence Status reviewed

Secondary Information

Protein Function  oligoribonuclease activity.ability to degrade small single-stranded RNA and DNA fragments.
Biochemical Properties REXO2 has conserved two AUG translation initiation sites.3' to 5' exonuclease activity specific.Maintaining Mitochondrial Structure.its depletion Severely Affects Mitochondrial Nucleic Acid Content.Cofactor for this enzyme is Mn2+ or Mg2+.
PTMs Acetylation and phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A2VE52|ORN_BOVIN Oligoribonuclease, mitochondrial OS=Bos taurus OX=9913 GN=REXO2 PE=2 SV=1 MLGGSLGSRLLRGVGGTRGQFRARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQI IEMACLITDSDLNILAEGPNLIIKQPDELLDS*92MSDWCKEHHGKSGLTKAVKESTMTLQQA EY*122EFLSFVRQQTPPGLCPLAGNSVHADKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWY PEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKTDEKKRKIIENGENEKTVS
Predicted Disorder Regions 2 disordered segments; (1-9), (219-237)
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments  REXO2 depletion also has a negative effect on both replication and transcription in mitochondria, causing a robust depletion of mtDNA and of mtRNAs
Bibliography Bruni F, Gramegna P, Oliveira JM, Lightowlers RN, Chrzanowska-Lightowlers ZM. REXO2 is an oligoribonuclease active in human mitochondria. PLoS One. 2013 May 31;8(5):e64670. doi: 10.1371/journal.pone.0064670. PMID: 23741365; PMCID: PMC3669425.