Search by BoMiProt ID - Bomi7729


Primary Information

BoMiProt ID Bomi7729
Protein Name Olfactomedin-like protein 3
Organism Bos taurus
Uniprot IdQ0VCP3
Milk FractionWhey,Casein
Ref Sequence Id NP_001068665.1
Aminoacid Length 406
Molecular Weight 45886
Fasta Sequence https://www.uniprot.org/uniprot/Q0VCP3.fasta
Gene Name OLFML3
Gene Id 505318
Protein Existence Status reviewed

Secondary Information

Protein Function dorsoventral patterning during early development.Stabilizes axial formation by restricting chordin (CHRD) activity on the dorsal side. Acts by facilitating the association between the tolloid proteases and their substrate chordin (CHRD), leading to enhance chordin (CHRD) degradation.
Biochemical Properties 406 amino acid residues.It contains a highly conserved OFL domain at the C-terminal, whereas a more variable coiled-coil domain at N-terminal region
PTMs Disulfide bond, Glycosylation on Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0VCP3|OLFL3_BOVIN Olfactomedin-like protein 3 OS=Bos taurus OX=9913 GN=OLFML3 PE=2 SV=1 MGPHTQLLILLLLSWLGPLQGQQHHLVEYMERRLAALEERLAQCQDQSSRHAAELRDFKN KMLPLLEVAEKEREALRTEADTISGRVDRLEREVDYLETQNPALPCVEVDEKVTGGPGTK GKGRRNEKYDMITDCGYTISQVRSMKILKRFGGPAGLWTKDPLGPAEKIYVLDGTQNDTA FVFPRLRDFTLAMAARKASRVRVPFPWVGTGQLVYGGFLYYARRPPGGPGGGGELQNTLQ LIKFHLAN*248RTVVDSSVFPAEGLIPPYGLTADTYIDLAADEEGLWAVYATREDDRHLCLAK LDPQTLDTEQQWDTPCPRENAEAAFVICGTLYVVYNTRPASRARIQCSFDASGTLTPERA ALPYFPRRYGAHASLRYNPRERQLYAWDDGYQIVYKLEMRKKEEEV
Predicted Disorder Regions 1 disordered segment; (104-127), 403rd disordered residue
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments abundant expression in placenta and moderate expression in heart and liver, weak in skeletal muscle, small intestine, lung, and kidney, and very weak in colon, spleen, thymus, and brain.no expression has been detected in peripheral blood leukocytes 
Bibliography Jin Y, Li JL. Olfactomedin-like 3: possible functions in embryonic development and tumorigenesis. Chin Med J (Engl). 2019 Jul 20;132(14):1733-1738. doi: 10.1097/CM9.0000000000000309. PMID: 31261202; PMCID: PMC6759097.