Search by BoMiProt ID - Bomi7728


Primary Information

BoMiProt ID Bomi7728
Protein Name Olfactomedin-like protein 2B
Organism Bos taurus
Uniprot IdA6QLD2
Milk FractionWhey
Ref Sequence Id NP_001093824.1
Aminoacid Length 759
Molecular Weight 84493
Fasta Sequence https://www.uniprot.org/uniprot/A6QLD2.fasta
Gene Name OLFML2B
Gene Id 513053
Protein Existence Status reviewed

Secondary Information

Protein Function bind chondroitin sulphate-E and heparin selectively to regulate the binding of CS-E to growth factors,take part in ECM organization.
Biochemical Properties Contain signal sequence at their N-terminal followed by two tandem CXCXCX9C motifs, a putative coiled-coil region, a serine/threonine-rich region, an OLF domain in their C-terminal, and two or three potential N-glycosylation sites.
Significance in milk Exosomes
PTMs O and N glycosylated.
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QLD2|OLM2B_BOVIN Olfactomedin-like protein 2B OS=Bos taurus OX=9913 GN=OLFML2B PE=2 SV=1 MAKSLLLVLCFALVTTLGWGYSAPPTGTTEPPDVQTVAPTEDETLQNEADNQENVLSQLL GDYDKVKAVSEGSDCQCKCVVRPLGRDACQRVNAGTSRKEDFYTVETITSGPSCKCACVA PPSALNPCEGDFRLQKLREADSRDLKLSTIIDMLEGAFYGLDLLKLHSVTTKLVGRVDKL EEEISKN*187LTKENEQIREDVEEIRTEMNKRGKEN*213CSNNILDSIPDIRSALQRDAAAAYTHP EYEERFLQEETVSQQIKSIKLLQTRPLAPPEVVKPQRPLQRQVHLRGRPASRPTVIRGIT YYKAKDPEEENDIEEHQDEFFSGEHGMDLLIEDQLLRHNQLLTSATRRPAATGRSAAVTA DAGTTSAGTPTTALPSARLPASTAAPSTPDPAVSASVEQFSTPLPTTSVSPDPTEEAVPT PFTQVPATTVAHTATQQPPASAPPSAAPEDAFVEATHTAPVPPPPVRTDSPGKDSTARQG TVPPGPTLSPEEEDDIRNVIGRCKDTLSTITGPITQNTYGRNEGAWMKDPLAKDERIYVT NYYYGNTLVEFRNLENFKQGRWSNSYKLPYSWIGTGHVVYNGAFYYNRAFTRNIIKYDLK QRYVAAWAMLHDVAYEEATPWRWQGHSDVDFAVDENGLWLIYPALDDEGFSQEVIVLSKL NAVDLSTQKETTWRTGLRRNLYGNCFVICGVLYAVDSHNQRNAN*704ISYAFDTHTNTQIVPR LLFENEYSYTTQIDYNPKDRLLYAWDNGHQVTYHVIFAY
Predicted Disorder Regions 23-48, 237-246, 263-266, 304-309, 322-484
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Lin J, Xu X, Li T, Yao J, Yu M, Zhu Y, Sun D. OLFML2B Is a Robust Prognostic Biomarker in Bladder Cancer Through Genome-Wide Screening: A Study Based on Seven Cohorts. Front Oncol. 2021 Nov 15;11:650678. doi: 10.3389/fonc.2021.650678. PMID: 34868901; PMCID: PMC8634430.