Search by BoMiProt ID - Bomi7720


Primary Information

BoMiProt ID Bomi7720
Protein Name O(6)-methylguanine-induced apoptosis 2(MAPO2)/Sperm-tail PG-rich repeat-containing protein 1
Organism Bos taurus
Uniprot IdA6QQ60
Milk FractionWhey
Ref Sequence Id NP_001095774.1
Aminoacid Length 335
Molecular Weight 37104
Fasta Sequence https://www.uniprot.org/uniprot/A6QQ60.fasta
Gene Name STPG1
Gene Id 616738
Protein Existence Status reviewed

Secondary Information

Protein Function O6 -Methylguanines (O6 -meG), which are produced in DNA by the action of alkylating agents, are mutagenic and cytotoxic, and induce apoptosis in a mismatch repair (MMR) protein-dependent manner.
Biochemical Properties  MAPO1 may play a role in the signal-transduction pathway of apoptosis induced by O(6)-methylguanine-mispaired lesions.
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QQ60|STPG1_BOVIN O(6)-methylguanine-induced apoptosis 2 OS=Bos taurus OX=9913 GN=STPG1 PE=2 SV=1 MDNSTQKDQHSGKKYSRKANKVQKGFTAAYPTQSSIPYKYQPLIIPESEKKGFNSQAKRF YHKQDDIPGPGFY*73NVIHQSPVFDSVSLSKKGTCTFPSMCARLDTIVSKFPAANAYTIPSR LVSKKDFSNSCSSMFQLPSYEKVLKFETPAPNQYNASDSCCKQANNVCARAGFVSKTQRG LFTVSKTGPAPGHYDVNESLVKQSPKILMSCFKSKTDRGLKLTSTGPGPGYYNPNGHPKV QKKTLIPRNPILNFSAQPLPLPPKPPLPGPGQYEIVDYTGPRKHFISSASFVSNTRRWTA GPSQPGMPGPATYRPEFPGKQSFLYNEDNKWIPVL
Predicted Disorder Regions 1-28, 50-61, 187-196, 206-232, 242-254, 262-272, 295-316
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments The MMR complex, composed of MutSα (MSH2/MSH6 heterodimer) and MutLα (MLH1/PMS2 heterodimer), recognizes O6-meG/T mismatch produced during the 1st round of DNA replication and promotes the activation of ATR and CHK1 kinases, which is characterized by the phosphorylation of specific amino acids; however, progression of the cell cycle is not perturbed.
Bibliography 1.Rikitake M, Fujikane R, Obayashi Y, Oka K, Ozaki M, Hidaka M. MLH1-mediated recruitment of FAN1 to chromatin for the induction of apoptosis triggered by O6 -methylguanine. Genes Cells. 2020 Mar;25(3):175-186. doi: 10.1111/gtc.12748. Epub 2020 Feb 6. PMID: 31955481. 2.