Primary Information |
|---|
| BoMiProt ID | Bomi7720 |
|---|
| Protein Name | O(6)-methylguanine-induced apoptosis 2(MAPO2)/Sperm-tail PG-rich repeat-containing protein 1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A6QQ60 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001095774.1 |
|---|
| Aminoacid Length | 335 |
|---|
| Molecular Weight | 37104 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | STPG1 |
|---|
| Gene ID | 616738 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | O6 -Methylguanines (O6 -meG), which are produced in DNA by the action of alkylating agents, are mutagenic and cytotoxic, and induce apoptosis in a mismatch repair (MMR) protein-dependent manner. |
|---|
| Biochemical Properties | MAPO1 may play a role in the signal-transduction pathway of apoptosis induced by O(6)-methylguanine-mispaired lesions. |
|---|
| PTMs | Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A6QQ60|STPG1_BOVIN O(6)-methylguanine-induced apoptosis 2 OS=Bos taurus OX=9913 GN=STPG1 PE=2 SV=1
MDNSTQKDQHSGKKYSRKANKVQKGFTAAYPTQSSIPYKYQPLIIPESEKKGFNSQAKRF
YHKQDDIPGPGFY*73NVIHQSPVFDSVSLSKKGTCTFPSMCARLDTIVSKFPAANAYTIPSR
LVSKKDFSNSCSSMFQLPSYEKVLKFETPAPNQYNASDSCCKQANNVCARAGFVSKTQRG
LFTVSKTGPAPGHYDVNESLVKQSPKILMSCFKSKTDRGLKLTSTGPGPGYYNPNGHPKV
QKKTLIPRNPILNFSAQPLPLPPKPPLPGPGQYEIVDYTGPRKHFISSASFVSNTRRWTA
GPSQPGMPGPATYRPEFPGKQSFLYNEDNKWIPVL
|
|---|
| Predicted Disorder Regions | 1-28, 50-61, 187-196, 206-232, 242-254, 262-272, 295-316 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | The MMR complex, composed of MutSα (MSH2/MSH6 heterodimer) and MutLα (MLH1/PMS2 heterodimer), recognizes O6-meG/T mismatch produced during the 1st round of DNA replication and promotes the activation of ATR and CHK1 kinases, which is characterized by the phosphorylation of specific amino acids; however, progression of the cell cycle is not perturbed. |
|---|
| Bibliography | 1.Rikitake M, Fujikane R, Obayashi Y, Oka K, Ozaki M, Hidaka M. MLH1-mediated recruitment of FAN1 to chromatin for the induction of apoptosis triggered by O6 -methylguanine. Genes Cells. 2020 Mar;25(3):175-186. doi: 10.1111/gtc.12748. Epub 2020 Feb 6. PMID: 31955481. 2. |
|---|
