Search by BoMiProt ID - Bomi7703


Primary Information

BoMiProt ID Bomi7703
Protein Name Nucleoporin SEH1/GATOR complex protein SEH1/Nup107-160 subcomplex subunit SEH1
Organism Bos taurus
Uniprot IdA7YY75
Milk FractionWhey
Ref Sequence Id NP_001096559.1
Aminoacid Length 360
Molecular Weight 39641
Fasta Sequence https://www.uniprot.org/uniprot/A7YY75.fasta
Gene Name SEH1L
Gene Id 506509
Protein Existence Status reviewed

Secondary Information

Protein Function Component of the Nup107-160 complex of the nuclear pore complex (NPC).essential for the association of both the GATOR2 complex and nucleoporin Nup153 with mitotic chromosomes.required for efficient localisation of the chromosomal passenger complex (CPC).
PTMs phosphorylation on Ser and Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7YY75|SEH1_BOVIN Nucleoporin SEH1 OS=Bos taurus OX=9913 GN=SEH1L PE=2 SV=1 MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGEWHCTASWKTHSGSV WRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVK FAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHAP MIAVGSDDSS*190PNAMAKVQIFEYNENTRKYAKAETLLTVTDPVHDIAFAPNLGRSFHILAI ATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDG CVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGNSNPSVGSNIPSLQNSLNGSSAGRKHS
Predicted Disorder Regions 330-360
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs O-GlcNAcylation and ubiquitination to regulate Nup turnover. phosphorylation and ubiquitination play destructive roles in disassembling NPCs and degrading Nups, respectively.
Bibliography Platani M, Samejima I, Samejima K, Kanemaki MT, Earnshaw WC. Seh1 targets GATOR2 and Nup153 to mitotic chromosomes. J Cell Sci. 2018 May 1;131(9):jcs213140. doi: 10.1242/jcs.213140. PMID: 29618633; PMCID: PMC5992584.