Search by BoMiProt ID - Bomi7673


Primary Information

BoMiProt ID Bomi7673
Protein Name Nuclear speckle splicing regulatory protein 1/Coiled-coil domain-containing protein 55/Nuclear speckle-related protein 70/NSrp70
Organism Bos taurus
Uniprot IdQ2KIC0
Milk FractionWhey
Ref Sequence Id NP_001039927.1
Aminoacid Length 559
Molecular Weight 66431
Fasta Sequence https://www.uniprot.org/uniprot/Q2KIC0.fasta
Gene Name NSRP1/CCDC55/ NSRP70
Gene Id 539841
Protein Existence Status reviewed

Secondary Information

Protein Function RNA-binding protein that mediates pre-mRNA alternative splicing regulation.
PTMs Isopeptide bond formation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KIC0|NSRP1_BOVIN Nuclear speckle splicing regulatory protein 1 OS=Bos taurus OX=9913 GN=NSRP1 PE=2 SV=1 MAIPGRQYGLILPKKAQQLHPVLQKPS*27VFGNDS*33DDDDDETSVSESLQREAAKKQAMKQTK LEIQKALAEDSTVYEYDSIYDEMQKKKEESNPKLLLGKDRKPKYIHNLLKAVEIRKKEQE KRMEKKIQREREMEKGEFDDKEAFVTSAYKKKLQERAEEEERERRAAALEARLDVTKQRD LSGFYRHLLNQAVGEEEVPTCSFREARSEIKEEKSKGYSDEVSSESRIPPENCIRQTGVK VEENPDADS*249DFDAKS*255S*256ENDEMEGDKGNCRREKGTET*276LSSHSKHHRNPARSPSSSEEREHGTQCHTKSSRSRGHEKREDEHQERPAREQDSYHTDRDSRKEKRDSHRHRESSHRDSHWKRH EEERLRGRDERERNDREWKREKDREKYPSREQERHRQRNNYDRHNEKGCEKEEKSKEKEE HVKARKERYENSDKYRDREKREVSVESSERNRDRKESS*458PNSRAKDRFVNQERASKMRDME KDKERNPEKPSSSEASLGAKHRITEECQETGKEQERLHETVNKFAKRSNEETVTSARDRY LARQMARINAKTYIEKEDD
Predicted Disorder Regions 1-106, 124-148, 162-537, 551-558
DisProt Annotation
TM Helix Prediction No TM helices