Search by BoMiProt ID - Bomi7630


Primary Information

BoMiProt ID Bomi7630
Protein Name Nuclear autoantigenic sperm protein
Organism Bos taurus
Uniprot IdQ2T9P4
Milk FractionWhey
Ref Sequence Id NP_001033177.2
Aminoacid Length 777
Molecular Weight 83688
Fasta Sequence https://www.uniprot.org/uniprot/Q2T9P4.fasta
Gene Name NASP
Gene Id 512427
Protein Existence Status reviewed

Secondary Information

Protein Function Nuclear autoantigenic sperm protein (NASP) is associated with DNA replication, cell proliferation, and cell cycle progression through its specific binding to histones.
Biochemical Properties A multichaperone nucleosome-remodeling complex that contains the H1 linker histone chaperone nuclear autoantigenic sperm protein (NASP) has recently been described. Linker histones (H1) are required for the proper completion of normal development, and NASP transports H1 histones into nuclei and exchanges H1 histones with DNA.
PTMs N6-Acetylation at Lys, Isopeptide bond formation, Phosphorylation at Ser/Thr, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2T9P4|NASP_BOVIN Nuclear autoantigenic sperm protein OS=Bos taurus OX=9913 GN=NASP PE=2 SV=2 MAAESTATAAITAELVSADKIEEDAPAPSTSADKVESLDVDSEAKKLLGLGQKHLVMGDI PAAVNAFQEAASLLGKKYGETANECGEAFFFYGKSLLELARMENGVLGNALEGVHVEEEE GEKT*124EEES*128LVENNDNIDEEAREELREQVYDAMGEKEAQKTEDKSLVKPEMDKEQETEMEK GGREDMDIGEPAEELQEKVKSAPDQLTETTEEGKGAAAPEGLSEAEVTSKKPDQEIPGAE EGKS*244VSETDVQEECREKGGQGEVIVSIEEKPKEASKEQPVVTLEKQGTPVEIEAVKPVDM GGDEPKEQVAAS*312ESERGKAILEQLVGQELPSAEESPEVTTQAADASAAEAGSEVSEKPGG QDTVLPQDGAVNGLSAAGDHASTKPQTNAEGLIGTKDGS*399ALEKVRAELVPS*411QETKLSVEE SEAAGDGVETEVAQGATEQS*440PEDKVKIAANEEAQDKEEQMKEGEET*466EGS*469EEEDKENDKAE ETLNDS*486ALENKS*492LQENEEEEIGNLELAWDMLDLAKIIFKRQDTKEAQLYAAQAHLKLGEV SVESENYLQAVEEFQACLNLQEQYLEAHDRLLAETHYQLGLAYGYNSQYDEAVAQFSKSI EVIEKRMAVLNEQMKEAEGSPTEYEKEIEELKELLPEIREKIEDAKESQRS*651GNVAELALK ATLVESSTSGFT*672PSGGSSSVSMIASRKPTDGASS*694S*695NCVTDISHLVRKKRKPEEES*715PRKDDAKKAKQEPEVNGGS*734GDTISTGTEVAENMEEEAENKAESRAAVEGTVEAGATVESTAC
Predicted Disorder Regions 1-40, 115-497, 631-641, 665-777
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Mutation of nuclear autoantigenic sperm protein (NASP) gene aggravates autoimmune response in induced lupus model mice
Bibliography 1.Nagatomo H, Kohri N, Akizawa H, Hoshino Y, Yamauchi N, Kono T, Takahashi M, Kawahara M. Requirement for nuclear autoantigenic sperm protein mRNA expression in bovine preimplantation development. Anim Sci J. 2016 Mar;87(3):457-61. doi: 10.1111/asj.12538. Epub 2015 Dec 22. PMID: 26690724. 2.Zhan Q, Zhang J, Wang H, Wu X, Zhu Y, Xu Z, Ju J. [Mutation of nuclear autoantigenic sperm protein (NASP) gene aggravates autoimmune response in induced lupus model mice]. Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi. 2019 Sep;35(9):776-782. Chinese. PMID: 31750817. 3.Richardson RT, Alekseev OM, Grossman G, Widgren EE, Thresher R, Wagner EJ, Sullivan KD, Marzluff WF, O'Rand MG. Nuclear autoantigenic sperm protein (NASP), a linker histone chaperone that is required for cell proliferation. J Biol Chem. 2006 Jul 28;281(30):21526-21534. doi: 10.1074/jbc.M603816200. Epub 2006 May 25. PMID: 16728391.