Search by BoMiProt ID - Bomi7604


Primary Information

BoMiProt ID Bomi7604
Protein Name Notchless protein homolog 1
Organism Bos taurus
Uniprot IdQ58D20
Milk FractionWhey
Ref Sequence Id NP_001014887.1
Aminoacid Length 486
Molecular Weight 53229
Fasta Sequence https://www.uniprot.org/uniprot/Q58D20.fasta
Gene Name NLE1
Gene Id 509793
Protein Existence Status reviewed

Secondary Information

Protein Function  proper embryonic development.survival of cells of the inner cell mass upon implantation.axial skeleton formation
PTMs phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus OX=9913 GN=NLE1 PE=2 SV=3 MAAAAAADEAATRDVQRLLVQFQDEGGQLLGSPFDVPVDITPDKLQLVCNALLAQEDPLP LAFYVHDAEIVSSLGRTLES*80QAVETEKVLDIIYQPQAIFRVRAVTRCTSSLEGHSEAVIS VAFSPTGKYLASGSGDTTVRFWDLSTETPHFTCQGHRHWVLSISWSPDGKKLASGCKNGQ ILLWDPSTGKQVGRALTGHSKWITALSWEPLHANPECRYVASSSKDGSVRVWDTTAGRCE RTLTGHAQSVTCLRWGGDGLLYSASQDRTIKVWRAHDGVLCRTLQGHGHWVNTMALSTDY ALRTGAFEPAEASVNAQDLRGSLQELKERALSRYNLVRGQGPERLVSGSDDFTLFLWSPA EDKKPLARMTGHQALINQVVFSPDSRVIASASFDKSIKLWDGRTGKYLASLRGHVAAVYQ IAWSADSRLLVSGSSDSTLKVWDVKAQKLSTDLPGHADEVYAVDWSPDGQRVASGGKDKC LRIWRR
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Beck-Cormier S, Escande M, Souilhol C, Vandormael-Pournin S, Sourice S, Pilet P, Babinet C, Cohen-Tannoudji M. Notchless is required for axial skeleton formation in mice. PLoS One. 2014 May 29;9(5):e98507. doi: 10.1371/journal.pone.0098507. PMID: 24875805; PMCID: PMC4038589.