Search by BoMiProt ID - Bomi7527


Primary Information

BoMiProt ID Bomi7527
Protein Name NLR family CARD domain-containing protein 4/Ice protease-activating factor
Organism Bos taurus
Uniprot IdF1MHT9
Milk FractionWhey
Ref Sequence Id NP_001179252.2
Aminoacid Length 1017
Molecular Weight 115578
Fasta Sequence https://www.uniprot.org/uniprot/F1MHT9.fasta
Gene Name NLRC4/IPAF
Gene Id 512480
Protein Existence Status reviewed

Secondary Information

Protein Function Expression of NLRC4 significantly increased in thyroid tissues from patients with autoimmune thyroiditis (AIT), and enhanced posttranslational maturation of caspase-1, IL-18 and IL-1β was also observed.
Biochemical Properties Inflammasomes are intracellular multi-protein plats composed of NOD-like receptors (NLRs)/AIM-like receptors, the apoptosis-associated speck-like protein that contains caspase activation recruitment domain (ASC) and the inflammatory effector pro caspase-1.The NLR family, pyrin domain containing 3 (NLRP3), pyrin domain containing 1 (NLRP1), and caspase activation recruitment domain containing 4 (NLRC4) are the most studied intracellular pattern recognition receptors; they are known for their ability to assemble canonical inflammasomes in response to specific PAMPs and DAMPs
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|F1MHT9|NLRC4_BOVIN NLR family CARD domain-containing protein 4 OS=Bos taurus OX=9913 GN=NLRC4 PE=3 SV=3 MNFIKENSQVLIQRMGMTVIKQILDELFVWNVMNYEEVNVICGEKFEQDAARGVIHMILK KGSEACNLFLKSLEKWNYPLFQELHGLSLFHQMSEEDLDDLAQELKYFYQSPSFLNFYPL GEDIDIMFNLKSTFTEPVLWKKDQHHHRLEQLTLSGLLDTLQSPCIIEGESGKGKSTLLQ RIAMLWASGECQALTKFKLVFFLRLSRAQGGLFETLSDQLLDIPDVISKQTFMARLLKLR QRVLFLLDGYNEFKAQNCPEIEALIKENHRFKNMVIVTTTTESLRHIRQFGALIAEVGDM TESSAQALIQEVLRKEFAEDLLLQIQKSRCLRNLMKTPLFVVITCAIQMGKSEFHSHTQT TLFCTFYDLLINKNRHKRKGLAPSEVTQSLDHCGDLALEGVFSRRFDFEPDDLSNVNEDV LLTTGLLCKYTAQRFKPKYKFFHQSFQEYTAGRRLSSLLTSGEPAEVTKGNGHLQKMVSI SDITSKYSNLLLYTCGSSAEATRTVLKHLSSVYQHGSLLGLSVTKRPLWRQES*533MQNMKST TVQEILKAININSFTECGINLFHESISTSSLSKEFEDFFRGKSLYINSENIPDYLFDFFE DLPNCASALDFVKLDFYGGAVRDISGNQDQEFSGTYIPSRAVSLFFNWKQEFKTLDVTLR DFCKLSKKDIKYLEKIFSSATSLRLHIKRCVGMAGSLSSVLSTCKNIHSLIVEASPLTLE DEQHITSVTNLQTLGVHDLQIQRLPGGLTDNLGNLKNLMKLILDNIQMNEEDALKLAEGL TNLKKMCLLRLTHLSDIGEGMDYIVKSLSAEPCDLKEIQLVSCCLSGNAVKTLAQNLHNL ARLSILDLSENHLEKDGKEALQQLIDRLHILEQLTVLMLPWCGDVRVSLARLLEQLERVP QLVKLGLKNWRLTDAEIRILGVFFEKNPLENFQQLDLAGNCVSSDGWLAFMSGFENLKEL VFFDFSTKGLLPDASLVRKLSHVLSKLTFLQEVQLVGWQLDDDDVSVLKGAFKLVIA
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs  Phosphorylation is essential for NLRC4 inflammasome function to promote caspase-1 activation and pyroptosis.
Bibliography Liu L, Chan C. IPAF inflammasome is involved in interleukin-1β production from astrocytes, induced by palmitate; implications for Alzheimer's Disease. Neurobiol Aging. 2014 Feb;35(2):309-21. doi: 10.1016/j.neurobiolaging.2013.08.016. Epub 2013 Sep 20. Erratum in: Neurobiol Aging. 2014 Jun;35(6):e13. PMID: 24054992; PMCID: PMC3832124. 2.. Schroder K, Tschopp J. The inflammasomes. Cell (2010) 140(6):821–32. doi:10.1016/j.cell.2010.01.040. 3.Latz E, Xiao TS, Stutz A. Activation and regulation of the inflammasomes. Nat Rev Immunol (2013) 13(6):397–411. doi:10.1038/nri3452.