Search by BoMiProt ID - Bomi7509


Primary Information

BoMiProt ID Bomi7509
Protein Name Nitric oxide synthase-interacting protein/E3 ubiquitin-protein ligase NOSIP/RING-type E3 ubiquitin transferase NOSIP
Organism Bos taurus
Uniprot IdQ3SWY5
Milk FractionWhey
Ref Sequence Id NP_001068970.1
Aminoacid Length 302
Molecular Weight 33043
Fasta Sequence https://www.uniprot.org/uniprot/Q3SWY5.fasta
Gene Name NOSIP
Protein Existence Status reviewed

Secondary Information

Protein Function E3 ubiquitin-protein ligase that is essential for proper development of the forebrain, the eye, and the face. Catalyzes monoubiquitination of serine/threonine-protein phosphatase 2A (PP2A) catalytic subunit PPP2CA/PPP2CB
Significance in milk play pivotal roles in corpus luteum (CL) function.Elevated NO at an early luteal stage is likely to play an important role in angiogenesis, whereas reduced levels of NO during luteal regression may facilitate the sustained up-regulation of Endothelin-1 levels during luteolysis.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SWY5|NOSIP_BOVIN Nitric oxide synthase-interacting protein OS=Bos taurus OX=9913 GN=NOSIP PE=2 SV=1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLS*36RDAVKDFDCCCLSLQPCHDPVVTP DGYLYEREAILEYILHQKKEIARQMKAYEKQRGARREEQKELQRAAAQDHVRGFLEKEAA IVSRPLNPFTPKAASAGNGPDDAQPGSSAGPAGKDKDKALPSFWIPSLTPEAKATKLEKP SRIVTCPMSGKPLRMSDLTPVRFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVL RPSGAVVTLECVEKLIRKDMVDPVTGEKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVM QA
Predicted Disorder Regions 1-5, 79-191, 295-302
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Maya Rosiansky-Sultan, Eyal Klipper, Katharina Spanel-Borowski, Rina Meidan, Inverse Relationship between Nitric Oxide Synthases and Endothelin-1 Synthesis in Bovine Corpus Luteum: Interactions at the Level of Luteal Endothelial Cell, Endocrinology, Volume 147, Issue 11, 1 November 2006, Pages 5228–5235, https://doi.org/10.1210/en.2006-0795 2.Yu, X., Zhong, Y., Zhu, Z., Wu, T., Shen, A., & Huang, Y. (2012). Increased expression of nitric oxide synthase interacting protein (NOSIP) following traumatic spinal cord injury in rats. Journal of molecular histology, 43(6), 661–668. https://doi.org/10.1007/s10735-012-9460-9