Search by BoMiProt ID - Bomi7478


Primary Information

BoMiProt ID Bomi7478
Protein Name N-fatty-acyl-amino acid synthase/hydrolase PM20D1
Organism Bos taurus
Uniprot IdQ2T9M7
Milk FractionWhey,MFGM
Ref Sequence Id NP_001033189.1
Aminoacid Length 503
Molecular Weight 55785
Fasta Sequence https://www.uniprot.org/uniprot/Q2T9M7.fasta
Gene Name PM20D1
Gene Id 513852
Protein Existence Status reviewed

Secondary Information

Protein Function PM20D1 is a secreted enzyme that regulates N-acyl amino acids.Increased PM20D1 or N-acyl amino acid administration augments energy expenditure.
PTMs Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2T9M7|P20D1_BOVIN N-fatty-acyl-amino acid synthase/hydrolase PM20D1 OS=Bos taurus OX=9913 GN=PM20D1 PE=2 SV=1 MARPSVCLLASLSALLLGIAAVSRSKGLRGTESQREPRIPSQFSQEQRIAMKEALKGAIQ IPTVSFSPKELN*72TTALAEFGEYIRKVFPTVFHTSFIRHEVVGNYSHLFTIKGSDPSMQPY ILLAHIDVVPAPDKGWDVPPFSGLERDGFIYGRGTLDNKNYLMAILQALELLLIRNYIPR RSFFIALGHDEEISGINGAQKISALLQARGVQLAFVVDEGSFILDGFIPYLKKPFAMVSV SEKGAINLMLQVNTTTGHSSAPPKETSIGILAAAVSRLEQTPMPNMFGSGPLMTAVEQLA NEFPFPTNIVLNNLWLFRPLVSRLMERNYITNSLVRTTTALTMFNAGVKVNVIPPVAEAI INFRLHPAQTVQEVLKLAKDIVADDRIQFHVLDAFDPLPISPSDDQALGYQLLRQTIHSV FPEVNIVAPGTCIGNTDSRHYLNLTTGIYRFNPIYLQPQDFSSIHGINEKISVQAYETQV KFVFEFIQNGDTDEETVPHLHEL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Long JZ, Svensson KJ, Bateman LA, Lin H, Kamenecka T, Lokurkar IA, Lou J, Rao RR, Chang MR, Jedrychowski MP, Paulo JA, Gygi SP, Griffin PR, Nomura DK, Spiegelman BM. The Secreted Enzyme PM20D1 Regulates Lipidated Amino Acid Uncouplers of Mitochondria. Cell. 2016 Jul 14;166(2):424-435. doi: 10.1016/j.cell.2016.05.071. Epub 2016 Jun 30. PMID: 27374330; PMCID: PMC4947008.