Primary Information |
---|
BoMiProt ID | Bomi7446 |
---|
Protein Name | Neuromodulin/Axonal membrane protein GAP-43/Calmodulin-binding protein P-57/Growth-associated protein 43 |
---|
Organism | Bos taurus |
---|
Uniprot Id | P06836 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_976234.2 |
---|
Aminoacid Length | 242 |
---|
Molecular Weight | 25066 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/P06836.fasta |
---|
Gene Name | GAP43 |
---|
Gene Id | 281777 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | neuron growth and regeneration.Neurospecific calmodulin binding protein that is implicated in neurite extension, axonal elongation and long-term potentiation.neuromodulin binds and concentrates calmodulin on growth cone membranes and that stimulation of protein kinase C releases high local concentrations of calmodulin in the growth cone. |
---|
Biochemical Properties | A nine amino acid fragment (RGHITRKKL) has been identified as the putative calmodulin binding domain of neu~romodulin.bovine brain neuromodulin Tertiary and secondary structure(predicted by circular dichreism spectroscopy) ~-helix 1% IB-sheet 21% random coil 78%.Amino acid composition Ala 24% Pro 9% acidic amino acids 32%. |
---|
PTMs | Palmitatoylation, Phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P06836|NEUM_BOVIN Neuromodulin OS=Bos taurus OX=9913 GN=GAP43 PE=1 SV=3
MLCCMRRTKQVEKNDEDQKIEQDGIKPEDKAHKAATKIQAS*41FRGHITRKKLKGEKKGDAP
AAEAEANEKDEAAVAEGTEKKEGEGS*86TPAEAAPGAGPKPEEKTGKAGETPSEEKKGEGAP
DAATEQAAPQAPAPSEEKAGSAETESATKASTDNS*155PS*157S*158KAEDAPAKEEPKQADVPAAVTA
AAATAPAAEDAAAMATAQPPTETAES*206S*207QAEEKIEAVDETKPKDSARQDEGKGEEREADQE
HA
|
---|
Predicted Disorder Regions | 1 disordered segment; (1-242) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | Phosphorylation of this protein by a protein kinase C is specifically correlated with certain forms of synaptic plasticity.Palmitoylation is regulated by ARF6 and is essential for plasma membrane association and axonal and dendritic filopodia induction |
---|
Bibliography | Liu YC, Storm DR. Regulation of free calmodulin levels by neuromodulin: neuron growth and regeneration. Trends Pharmacol Sci. 1990 Mar;11(3):107-11. doi: 10.1016/0165-6147(90)90195-e. PMID: 2151780. |