Search by BoMiProt ID - Bomi7446


Primary Information

BoMiProt ID Bomi7446
Protein Name Neuromodulin/Axonal membrane protein GAP-43/Calmodulin-binding protein P-57/Growth-associated protein 43
Organism Bos taurus
Uniprot IdP06836
Milk FractionWhey
Ref Sequence Id NP_976234.2
Aminoacid Length 242
Molecular Weight 25066
Fasta Sequence https://www.uniprot.org/uniprot/P06836.fasta
Gene Name GAP43
Gene Id 281777
Protein Existence Status reviewed

Secondary Information

Protein Function neuron growth and regeneration.Neurospecific calmodulin binding protein that is implicated in neurite extension, axonal elongation and long-term potentiation.neuromodulin binds and concentrates calmodulin on growth cone membranes and that stimulation of protein kinase C releases high local concentrations of calmodulin in the growth cone.
Biochemical Properties A nine amino acid fragment (RGHITRKKL) has been identified as the putative calmodulin binding domain of neu~romodulin.bovine brain neuromodulin Tertiary and secondary structure(predicted by circular dichreism spectroscopy) ~-helix 1% IB-sheet 21% random coil 78%.Amino acid composition Ala 24% Pro 9% acidic amino acids 32%.
PTMs Palmitatoylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P06836|NEUM_BOVIN Neuromodulin OS=Bos taurus OX=9913 GN=GAP43 PE=1 SV=3 MLCCMRRTKQVEKNDEDQKIEQDGIKPEDKAHKAATKIQAS*41FRGHITRKKLKGEKKGDAP AAEAEANEKDEAAVAEGTEKKEGEGS*86TPAEAAPGAGPKPEEKTGKAGETPSEEKKGEGAP DAATEQAAPQAPAPSEEKAGSAETESATKASTDNS*155PS*157S*158KAEDAPAKEEPKQADVPAAVTA AAATAPAAEDAAAMATAQPPTETAES*206S*207QAEEKIEAVDETKPKDSARQDEGKGEEREADQE HA
Predicted Disorder Regions 1 disordered segment; (1-242)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation of this protein by a protein kinase C is specifically correlated with certain forms of synaptic plasticity.Palmitoylation is regulated by ARF6 and is essential for plasma membrane association and axonal and dendritic filopodia induction
Bibliography Liu YC, Storm DR. Regulation of free calmodulin levels by neuromodulin: neuron growth and regeneration. Trends Pharmacol Sci. 1990 Mar;11(3):107-11. doi: 10.1016/0165-6147(90)90195-e. PMID: 2151780.