Search by BoMiProt ID - Bomi7438


Primary Information

BoMiProt ID Bomi7438
Protein Name Neuroendocrine convertase 2/NEC 2/Prohormone convertase 2/Proprotein convertase 2/PC2
Organism Bos taurus
Uniprot IdQ9GLR0
Milk Fractionwhey
Ref Sequence Id NP_776838.1
Aminoacid Length 638
Molecular Weight 70247
Fasta Sequence https://www.uniprot.org/uniprot/Q9GLR0.fasta
Gene Name PCSK2
Gene Id 281968
Protein Existence Status reviewed

Secondary Information

Protein Function Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Responsible for the release of glucagon from proglucagon in pancreatic A cells
Significance in milk stimulating feed intake of dairy cows during early lactation
PTMs Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q9GLR0|NEC2_BOVIN Neuroendocrine convertase 2 OS=Bos taurus OX=9913 GN=PCSK2 PE=2 SV=1 MRGGCISQGKAAAGLLFCVMVFASAERPVFTNHFLVELHRGGEEKARQVAAEHGFGVRKL PFAEGLYHFYHNGLAKARRRRSLQHQQQLERDPRVKRALQQEGFNRKKRGYRDINEIDIN VNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN YNAEASYDFSSNDPYPYPRYTDDWSNSHGTRCAGEVSAAANNNICGVGVAYGSKVAGIRM LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK RNPEAGVATTDLYGN*375CTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIP TTGKPVLTLTTDACEGKENFVRYLEHVQAVVTVN*514ATRRGDLNIN*524MTSPMGTKSILLSRRP RGDDAKVGFDKWPFMTTHTWGEDARGTWILELGFVGSAPQKGVLMEWTLMLHGTQSAPYI DQVVRDYQSKLAMSKKEELEEELDEAVQRSLKSILGKD
Predicted Disorder Regions 186-200, 272-284, 353-368, 424-426, 478-482, 631-635
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Hwang, S. R., Ng, S. M., Steineckert, B., Seidah, N. G., & Hook, V. Y. (2000). Molecular cloning demonstrates structural features of homologous bovine prohormone convertases 1 and 2. DNA and cell biology, 19(7), 409–419. https://doi.org/10.1089/10445490050085906