Search by BoMiProt ID - Bomi7406


Primary Information

BoMiProt ID Bomi7406
Protein Name Negative elongation factor E/NELF-E/RNA-binding protein RD
Organism Bos taurus
Uniprot IdQ0V898
Milk FractionWhey
Ref Sequence Id NP_001069672.1
Aminoacid Length 374
Molecular Weight 42331
Fasta Sequence https://www.uniprot.org/uniprot/Q0V898.fasta
Gene Name NELFE/RDBP
Gene Id 540158
Protein Existence Status reviewed

Secondary Information

Protein Function  negatively regulates the elongation of transcription by RNA polymerase II
Biochemical Properties  NELF is composed of five polypeptides, the smallest of which is identical to RD(Arg-Asp residues (RD motif)), a putative RNA-binding protein. DSIF and NELF are capable of repressing transcription at any point downstream of +50–60.NELF can only associate with, and inhibit, hypophosphorylated pol II.
PTMs formation of isopeptide bond,sumoylation,ADP-ribosylation,phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0V898|NELFE_BOVIN Negative elongation factor E OS=Bos taurus OX=9913 GN=NELFE PE=2 SV=1 MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTASQGGVKRSLS*51EQPVVDTAT ATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRS*113VS*115ADDDL QESSRRPQRKS*131LYESFVSS*139SDRLRELGPDGEEAEGPGAGDGPPRS*165FDWGYEERGGARSS*179AS*181PPRS*185RSRDRSRERNRDRDRDRDRERDRERDRDRDRDRERDRDRDRDRDRDRERDREGPF RRS*243DS*245FPERRAPRKGNTLYVYGEDMT*266PT*268LLRGAFS*275PFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVSIARKQPMLDAATGKSVWGSLAVQNS*347PKGCHRDKRTQIV YSDDVYKENLVDGF
Predicted Disorder Regions 3-248, 259-262, 327-334
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs ADP-ribosylation of NELF proteins by Poly(ADP-ribose) polymerases (PARPs) promotes transcription elongation.Also phosphorylated by CDK9 which helps in alleviating their repressive effect on transcription elongation .
Bibliography 1.Zlotorynski, E. ADP-ribosylation promotes transcription elongation. Nat Rev Mol Cell Biol 17, 397 (2016). https://doi.org/10.1038/nrm.2016.83 2.Chen L, Keppler OT, Schölz C. Post-translational Modification-Based Regulation of HIV Replication. Front Microbiol. 2018 Sep 11;9:2131. doi: 10.3389/fmicb.2018.02131. PMID: 30254620; PMCID: PMC6141784.