Search by BoMiProt ID - Bomi7375


Primary Information

BoMiProt ID Bomi7375
Protein Name NADPH--cytochrome P450 reductase/CPR/P450R
Organism Bos taurus
Uniprot IdQ3SYT8
Milk FractionWhey
Ref Sequence Id NP_001030467.1
Aminoacid Length 678
Molecular Weight 77021
Fasta Sequence https://www.uniprot.org/uniprot/Q3SYT8.fasta
Gene Name POR
Gene Id 532512
Protein Existence Status reviewed

Secondary Information

Protein Function Participates in Its Antifungal Activity via Regulating Cell Wall Integrity in Fission Yeast
Biochemical Properties NADPH-cytochrome P450 reductase, a protein of 678 amino acids that is highly similar 251 to the human POR (37% identity) and S. cerevisiae Ncp1p (38% identify)
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SYT8|NCPR_BOVIN NADPH--cytochrome P450 reductase OS=Bos taurus OX=9913 GN=POR PE=2 SV=3 MADSNMDAGTTTSEMVAEEVSLFSTTDVILFSLIVGVMTYWFLFRKKKEEVPEFTKIQTT TSS*63VKDRSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMAADPEEYDLA DLSSLPEIEKALAIFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKYAVFALGNKTYEH FNAMGKYVDKRLEQLGAQRIFDLGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEES SIRQYELMVHTDMDMAKVYTGEMGRLKSYENQKPPFDAKNPFLAVVTTNRKLNQGTERHL MHLELDISDSKIRYESGDHVAVYPANDSALVNQLGEILGADLDIIMSLNNLDEESNKKHP FPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPTEHEQLRKMASSSGEGKELYLRWV LEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEYET KTGRINKGVATSWLRAKEPAGENGGRALVPMYVRKSQFRLPFKATTPVIMVGPGTGVAPF IGFIQERAWLRQQGKEVGETLLYYGCRRSDEDYLYREELAGFHKDGALTQLNVAFSREQP QKVYVQHLLKKDKEHLWKLIHEGGAHIYVCGDARNMARDVQNTFYDIVAEQGAMEHAQAV DYVKKLMTKGRYSLDVWS
Predicted Disorder Regions (1-11)
DisProt Annotation
TM Helix Prediction 1TMH; (20-42)
Bibliography 1.Liu Q, Guo X, Jiang G, Wu G, Miao H, Liu K, Chen S, Sakamoto N, Kuno T, Yao F, Fang Y. NADPH-Cytochrome P450 Reductase Ccr1 Is a Target of Tamoxifen and Participates in Its Antifungal Activity via Regulating Cell Wall Integrity in Fission Yeast. Antimicrob Agents Chemother. 2020 Aug 20;64(9):e00079-20. doi: 10.1128/AAC.00079-20. PMID: 32571823; PMCID: PMC7449163.