Search by BoMiProt ID - Bomi7324


Primary Information

BoMiProt ID Bomi7324
Protein Name Na(+)/H(+) exchange regulatory cofactor NHE-RF3/Na(+)/H(+) exchanger regulatory factor 3/PDZ domain-containing protein 1/Sodium-hydrogen exchanger regulatory factor 3
Organism Bos taurus
Uniprot IdQ3T0X8
Milk FractionWhey
Ref Sequence Id NP_001029783.1
Aminoacid Length 520
Molecular Weight 57175
Fasta Sequence https://www.uniprot.org/uniprot/Q3T0X8.fasta
Gene Name PDZK1/NHERF3/PDZD1
Gene Id 534439
Protein Existence Status reviewed

Secondary Information

Protein Function NHE-RF mediates protein kinase A regulation of Na(+)-H+ exchanger NHE3 to which it is thought to bind via one of its two PDZ domains. 
Biochemical Properties The carboxyl-terminal region of NHE-RF, downstream of the PDZ domains, interacts with the amino-terminal protein 4.1 domain-containing segment of merlin
PTMs Phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T0X8|NHRF3_BOVIN Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Bos taurus OX=9913 GN=PDZK1 PE=2 SV=1 MASTFNPRECKLTKQEGNSYGFFLRIEKDTDGHLVRVIEKGSPAEKAGLQDGDRVLRING VFVDKEEHMQVVDLVRKSGNSVTLLVLDGDSYEKAMKKQVDLKALGQS*108QEPSLNDKKAPS VMNGGAQMWMQPRLCYLVKEGGSYGFS*147LKTVQGKNGVYMTDIKPQGVAMKAGVLADDHLI EVNGENVEDAS*191HEEVVEKVKKSGSRVTFLLVDKETDKHHSEQKIKVKRETASLKLLPCQP RVVEMKKGS*249NGYGFYLRESPEQKGQIIKDIDPKSPAEKAGLKNNDLVVAVNGKSVESLDH DSVVEMIRKGGDQTSLLVVDKETDNIYKLAGFS*333PFFYYQSQELPNGS*347VKEVPAPTPAPLE VSSPETTEEVGDHKPKLCRLARGEDGYGFHLNAVRGQPGSFVKEVQKGGPADLAGLEDED VIIEVNGVNMLDESYEKVVDRIQSSGKTVT*450LLVCGKKAYDYFQAKKIPIVSSMADPLDDD PDPDEGRLEGS*491EQNSHMAEERERAHSTAS*509HS*511S*512S*513NS*515EDTEM
Predicted Disorder Regions 220-228, 346-354, 462-465, 485-520
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Murthy A, Gonzalez-Agosti C, Cordero E, Pinney D, Candia C, Solomon F, Gusella J, Ramesh V. NHE-RF, a regulatory cofactor for Na(+)-H+ exchange, is a common interactor for merlin and ERM (MERM) proteins. J Biol Chem. 1998 Jan 16;273(3):1273-6. doi: 10.1074/jbc.273.3.1273. PMID: 9430655.