Search by BoMiProt ID - Bomi7320


Primary Information

BoMiProt ID Bomi7320
Protein Name Myotubularin-related protein 9
Organism Bos taurus
Uniprot IdA7MB43
Milk FractionExosomes
Ref Sequence Id NP_001094657.1
Aminoacid Length 549
Molecular Weight 63486
Fasta Sequence https://www.uniprot.org/uniprot/A7MB43.fasta
Gene Name MTMR9
Gene Id 539174
Protein Existence Status reviewed

Secondary Information

Protein Function Acts as an adapter for myotubularin-related phosphatases. Increases lipid phosphatase MTMR6 catalytic activity, specifically towards phosphatidylinositol 3,5-bisphosphate, and MTMR6 binding affinity for phosphorylated phosphatidylinositols
PTMs Acetylation,Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7MB43|MTMR9_BOVIN Myotubularin-related protein 9 OS=Bos taurus OX=9913 GN=MTMR9 PE=2 SV=1 MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDK RFVGPLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVI EDGWHSFLPEQEFELYSSTISEWRLSYVNKEFSVCPSYPPAVIVPKAIDDDALRKVATFR HGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRPLN IAQQARAKGGGFEQEAHYPQWRRIHKSIDRYHILQESLIKLVESCNDQTQNMDRWLSKLE ASNWLTHIKEILTTACLAAQCLDREGASILIHGTEGTDSTLQVTSLAQIILEPRSRTIRG FEALIEREWLQAGHPFQQRCAQSAYCNSKQKWESPVFLLFLDCVWQILRQFPCSFEFNEN FLIMLFEHAYASQFGTFLGNNESERCKLKLQQKTMSLWSWVNRPSELSKFTNPLFEANNL VIWPSVAPQSLQLWEGIFLRWNRSSKYLDEAYEEMVNIIEYNKELQAKVNLLRRQLAELE TEDGVQES*548P
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices