Search by BoMiProt ID - Bomi7319


Primary Information

BoMiProt ID Bomi7319
Protein Name Myotrophin
Organism Bos taurus
Uniprot IdQ3T0F7
Milk FractionExosomes
Ref Sequence Id NP_976238.2
Aminoacid Length 118
Molecular Weight 12895
Fasta Sequence https://www.uniprot.org/uniprot/Q3T0F7.fasta
Gene Name MTPN
Gene Id 541099
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells occipital lobe 
Protein Function It may play a role in the initiation of cardiac hypertrophy as well as in normal growth of cardiac myocytes in humans.
PTMs Phosphorylation at Thr,N-Acetylation at Lys
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T0F7|MTPN_BOVIN Myotrophin OS=Bos taurus OX=9913 GN=MTPN PE=1 SV=3 MCDKEFMWALKNGDLDEVKDYVAKGEDVNRT*31LEGGRKPLHYAADCGQLEILEFLLLKGAD INAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Sil P, Misono K, Sen S. Myotrophin in human cardiomyopathic heart. Circ Res. 1993 Jul;73(1):98-108. doi: 10.1161/01.res.73.1.98. PMID: 8508536. 2.