Primary Information |
|---|
| BoMiProt ID | Bomi7308 |
|---|
| Protein Name | Myosin regulatory light chain 2, ventricular/cardiac muscle isoform |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3SZE5 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001030197.1 |
|---|
| Aminoacid Length | 166 |
|---|
| Molecular Weight | 18981 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | MYL2 |
|---|
| Gene ID | 505519 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly.This chain binds calcium. |
|---|
| Biochemical Properties | Myosin is a hexamer of 2 heavy chains and 4 light chains .Interacts with MYOC. |
|---|
| PTMs | Methylation and phosphorylation.Phosphorylated by MYLK3 and MYLK2 |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3SZE5|MLRV_BOVIN Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Bos taurus OX=9913 GN=MYL2 PE=1 SV=1
MSPKKAKKRAEGANYNVFS*19MFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDT*52FAALGRVN
VKNEEIDEMLKEAPGPINFTVFLQMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYIK
EMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
|
|---|
| Predicted Disorder Regions | 2 predicted disordered segment; (1-17), 77th residue |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
