Search by BoMiProt ID - Bomi7308


Primary Information

BoMiProt ID Bomi7308
Protein Name Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
Organism Bos taurus
Uniprot IdQ3SZE5
Milk FractionWhey
Ref Sequence Id NP_001030197.1
Aminoacid Length 166
Molecular Weight 18981
Fasta Sequence https://www.uniprot.org/uniprot/Q3SZE5.fasta
Gene Name MYL2
Gene Id 505519
Protein Existence Status reviewed

Secondary Information

Protein Function During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly.This chain binds calcium.
Biochemical Properties Myosin is a hexamer of 2 heavy chains and 4 light chains .Interacts with MYOC.
PTMs Methylation and phosphorylation.Phosphorylated by MYLK3 and MYLK2
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SZE5|MLRV_BOVIN Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Bos taurus OX=9913 GN=MYL2 PE=1 SV=1 MSPKKAKKRAEGANYNVFS*19MFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDT*52FAALGRVN VKNEEIDEMLKEAPGPINFTVFLQMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYIK EMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Predicted Disorder Regions 2 predicted disordered segment; (1-17), 77th residue
DisProt Annotation
TM Helix Prediction No TM helices