Search by BoMiProt ID - Bomi7288


Primary Information

BoMiProt ID Bomi7288
Protein Name Myocyte-specific enhancer factor 2C
Organism Bos taurus
Uniprot IdQ2KIA0
Milk FractionWhey
Ref Sequence Id NP_001039578.1
Aminoacid Length 441
Molecular Weight 47844
Fasta Sequence https://www.uniprot.org/uniprot/Q2KIA0.fasta
Gene Name MEF2C
Gene Id 512254
Protein Existence Status reviewed

Secondary Information

Protein Function cardiac morphogenesis and muscle differentiation, and is also involved in vascular development.Role in hippocampal-dependent learning and memory.Required for B-cell survival and proliferation in response to BCR stimulation. Involved in neurogenesis.MEF2C interacts with Sox18 for endothelial vessel morphogenesis.The interaction of MEF2C with Cabin1 is important for maintaining T-cell inactivation.
Biochemical Properties beta domain is for transcriptional activity.At the N-terminus of MEF2C, there are 56 amino acids in the MADS domain. This region is highly conserved and rich of A-T base pairs. The region's main role is to mediate DNA binding, dimerization, and co-factor interactions.Adjacent to the MEF2 domain is the HJURP-C (Holliday junction recognition protein C-terminal) domain, consisting of 29 amino acids.The NLS domain (nuclear localization signal) is located at the C-terminus of MEF2C, which controls nuclear translocation of the protein.
Significance in milk myeloid progenitor proliferation
PTMs Phosphorylation and Acetylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KIA0|MEF2C_BOVIN Myocyte-specific enhancer factor 2C OS=Bos taurus OX=9913 GN=MEF2C PE=2 SV=1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAS*59T DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDS*98PDPDADDS*106VGHS*110PESEDKYRKI NEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRN SMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNS*222PGLLVS*228PGNLNKNMQAKS*240 PPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLAT*293PVVSVAT*300 PTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHSMPP SALSQLGDRTTTPSRYPQHTRHEAGRS*387PVDSLSSCSSSYDGSDREDHRNEFHS*413PIGLTRP SPDERESPSVKRMRLSEGWAT
Predicted Disorder Regions 7 disordered segments;(190-196), (208-229), (286-300),( 311-339), (365-372), (390-423), (435-441)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation on Ser-59 enhances DNA binding activity.Acetylation on Lys-4 increases DNA binding and transactivation.
Additional Comments It has been reported that MEF2C-knockout mice die on embryonic day 9.5 from unnatural development of cardiovascular.
Bibliography Dong C, Yang XZ, Zhang CY, Liu YY, Zhou RB, Cheng QD, Yan EK, Yin DC. Myocyte enhancer factor 2C and its directly-interacting proteins: A review. Prog Biophys Mol Biol. 2017 Jul;126:22-30. doi: 10.1016/j.pbiomolbio.2017.02.002. Epub 2017 Feb 3. PMID: 28163053.