Search by BoMiProt ID - Bomi7287


Primary Information

BoMiProt ID Bomi7287
Protein Name Myocyte-specific enhancer factor 2A
Organism Bos taurus
Uniprot IdA2VDZ3
Milk FractionWhey
Ref Sequence Id NP_001077107.1
Aminoacid Length 492
Molecular Weight 52782
Fasta Sequence https://www.uniprot.org/uniprot/A2VDZ3.fasta
Gene Name MEF2A
Gene Id 407231
Protein Existence Status Reviewed

Secondary Information

Protein Function Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT]4TAR-3', found in numerous muscle-specific genes. Also involved in the activation of numerous growth factor- and stress-induced genes
Significance in milk bovine skeletal muscle myogenesis
PTMs Phosphorylation, acetylation, sumoylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A2VDZ3|MEF2A_BOVIN Myocyte-specific enhancer factor 2A OS=Bos taurus OX=9913 GN=MEF2A PE=2 SV=1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAS*59T DMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDS*98PDPDTSYVLTPHTEEKYKKINE EFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPSALSYTNPGSSLVSPSLAASSALADTSML SPPQATLHRNVSPGAPQRPPSTGSAGGMLSTSDLTVPNGAGSSPVGNGFVNSRAS*235PNLIG TTGANSLGKVMPTKS*255PPPPGGGSLGMNSRKPDLRVVIPPSSKGMMPPLNTQRISSSQATQ PLATPVVSVTT*311PSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFNS*347PGMLSLGQVSAWQ QHHLGQAALNSLVAGGQLSQGSNLSINTNQNINIKSEPIS*400PPRDRMT*407PSGFQQQQQPQPP PPPPQAPQPQPRQEVGRS*438PVDSLSSSSSSYDGSDREDPRGDFHSPVVLGRPPNSEDRESP SVKRMRMDAWVT
Predicted Disorder Regions 216-221, 324-347), (369-380), (401-452), (463-475)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Constitutive phosphorylation on Ser-400 promotes Lys-395 sumoylation thus preventing acetylation at this site.Sumoylation on Lys-395 is enhanced by PIAS1 and represses transcriptional activity.Acetylation on Lys-395 activates transcriptional activity. Proteolytically cleaved in cerebellar granule neurons on several sites by caspase 3 and caspase 7 following neurotoxicity.
Bibliography Huang, Y., Wu, X., Guo, J., & Yuan, J. (2016). Myocyte-specific enhancer binding factor 2A expression is downregulated during temporal lobe epilepsy. The International journal of neuroscience, 126(9), 786–796. https://doi.org/10.3109/00207454.2015.1062003