Primary Information |
---|
BoMiProt ID | Bomi7251 |
---|
Protein Name | Muellerian-inhibiting factor/Anti-Muellerian hormone/Muellerian-inhibiting substance |
---|
Organism | Bos taurus |
---|
Uniprot ID | P03972 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_776315.1 |
---|
Aminoacid Length | 575 |
---|
Molecular Weight | 60624 |
---|
FASTA Sequence |
Download |
---|
Gene Name | AMH |
---|
Gene ID | 280718 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | AMH is highly correlated with a woman's age and number of primordial ovarian follicles, and has been shown to predict time to menopause in women in their 40s. For these reasons, it was assumed that AMH levels could predict a woman's reproductive potential or serve as a 'fertility test'. |
---|
Biochemical Properties | Anti-Mullerian hormone (AMH) is a dimeric gly- € coprotein member of the transforming growth factorbeta-b family secreted by the granulosa cells of early antral follicles |
---|
Significance in milk | Anti-Müllerian hormone (AMH) is an endocrine marker that can help predict superovulatory responses to treatments administered to cows for embryo production. |
---|
PTMs | Disulfide bond formation, N-Linked Glycosylation at Asn |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P03972|MIS_BOVIN Muellerian-inhibiting factor OS=Bos taurus OX=9913 GN=AMH PE=1 SV=1
MPGPSLSLALVLSAMGALLRPGTPREEVFSTSALPREQATGSGALIFQQAWDWPLSSLWL
PGSPLDPLCLVTLHGSGN*78GSRAPLRVVGVLSSYEQAFLEAVRRTHWGLSDLTTFAVCPAG
NGQPVLPHLQRLQAWLGEPGGRWLVVLHLEEVTWEPTPLLRFQEPPPGGASPPELALLVV
YPGPGLEVTVTGAGLPGTQSLCLTADSDFLALVVDHPEGAWRRPGLALTLRRRGNGALLS
TAQLQALLFGADSRCFTRKTPALLLLLPARSSAPMPAHGRLDLVPFPQPRASPEPEEAPP
SADPFLETLTRLVRALAGPPARASPPRLALDPGALAGFPQGQVN*344LSDPAALERLLDGEEP
LLLLLPPTAATTGVPATPQGPKSPLWAAGLARRVAAELQAVAAELRALPGLPPAAPPLLA
RLLALCPGNPDSPGGPLRALLLLKALQGLRAEWRGRERSGSARAQRSAGAAAADGPCALR
ELSVDLRAERSVLIPETYQANNCQGACGWPQSDRNPRYGNHVVLLLKMQARGATLARPPC
CVPTAYTGKLLISLSEERISAHHVPNMVATECGCR
|
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | AMH levels peak in the late 20s and subsequently
decline with chronologic age until becoming undetectable in the mid-to-late 40s |
---|
Bibliography | 1.Hawkins Bressler L, Steiner A. Anti-Müllerian hormone as a predictor of reproductive potential. Curr Opin Endocrinol Diabetes Obes. 2018 Dec;25(6):385-390. doi: 10.1097/MED.0000000000000440. PMID: 30299431. 2.. Almog B, Shehata F, Suissa S, et al. Age-related normograms of serum
antimullerian hormone levels in a population of infertile women: a multicenter
study. Fertil Steril 2011; 95:2359–2363; 63 e1. 3.Bleil ME, Gregorich SE, Adler NE, et al. Race/ethnic disparities in reproductive age: an examination of ovarian reserve estimates across four race/ethnic
groups of healthy, regularly cycling women. Fertil Steril 2014; 101:199–207. |