Search by BoMiProt ID - Bomi7251


Primary Information

BoMiProt ID Bomi7251
Protein Name Muellerian-inhibiting factor/Anti-Muellerian hormone/Muellerian-inhibiting substance
Organism Bos taurus
Uniprot IdP03972
Milk FractionWhey
Ref Sequence Id NP_776315.1
Aminoacid Length 575
Molecular Weight 60624
Fasta Sequence https://www.uniprot.org/uniprot/P03972.fasta
Gene Name AMH
Gene Id 280718
Protein Existence Status reviewed

Secondary Information

Protein Function AMH is highly correlated with a woman's age and number of primordial ovarian follicles, and has been shown to predict time to menopause in women in their 40s. For these reasons, it was assumed that AMH levels could predict a woman's reproductive potential or serve as a 'fertility test'. 
Biochemical Properties Anti-Mullerian hormone (AMH) is a dimeric gly- € coprotein member of the transforming growth factorbeta-b family secreted by the granulosa cells of early antral follicles
Significance in milk Anti-Müllerian hormone (AMH) is an endocrine marker that can help predict superovulatory responses to treatments administered to cows for embryo production.
PTMs Disulfide bond formation, N-Linked Glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P03972|MIS_BOVIN Muellerian-inhibiting factor OS=Bos taurus OX=9913 GN=AMH PE=1 SV=1 MPGPSLSLALVLSAMGALLRPGTPREEVFSTSALPREQATGSGALIFQQAWDWPLSSLWL PGSPLDPLCLVTLHGSGN*78GSRAPLRVVGVLSSYEQAFLEAVRRTHWGLSDLTTFAVCPAG NGQPVLPHLQRLQAWLGEPGGRWLVVLHLEEVTWEPTPLLRFQEPPPGGASPPELALLVV YPGPGLEVTVTGAGLPGTQSLCLTADSDFLALVVDHPEGAWRRPGLALTLRRRGNGALLS TAQLQALLFGADSRCFTRKTPALLLLLPARSSAPMPAHGRLDLVPFPQPRASPEPEEAPP SADPFLETLTRLVRALAGPPARASPPRLALDPGALAGFPQGQVN*344LSDPAALERLLDGEEP LLLLLPPTAATTGVPATPQGPKSPLWAAGLARRVAAELQAVAAELRALPGLPPAAPPLLA RLLALCPGNPDSPGGPLRALLLLKALQGLRAEWRGRERSGSARAQRSAGAAAADGPCALR ELSVDLRAERSVLIPETYQANNCQGACGWPQSDRNPRYGNHVVLLLKMQARGATLARPPC CVPTAYTGKLLISLSEERISAHHVPNMVATECGCR
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments AMH levels peak in the late 20s and subsequently decline with chronologic age until becoming undetectable in the mid-to-late 40s
Bibliography 1.Hawkins Bressler L, Steiner A. Anti-Müllerian hormone as a predictor of reproductive potential. Curr Opin Endocrinol Diabetes Obes. 2018 Dec;25(6):385-390. doi: 10.1097/MED.0000000000000440. PMID: 30299431. 2.. Almog B, Shehata F, Suissa S, et al. Age-related normograms of serum antimullerian hormone levels in a population of infertile women: a multicenter study. Fertil Steril 2011; 95:2359–2363; 63 e1. 3.Bleil ME, Gregorich SE, Adler NE, et al. Race/ethnic disparities in reproductive age: an examination of ovarian reserve estimates across four race/ethnic groups of healthy, regularly cycling women. Fertil Steril 2014; 101:199–207.