Search by BoMiProt ID - Bomi7232


Primary Information

BoMiProt ID Bomi7232
Protein Name mRNA-decapping enzyme 1B
Organism Bos taurus
Uniprot IdQ3SZL6
Milk FractionWhey
Ref Sequence Id NP_001029639.1
Aminoacid Length 581
Molecular Weight 62880
Fasta Sequence https://www.uniprot.org/uniprot/Q3SZL6.fasta
Gene Name DCP1B
Gene Id 514548
Protein Existence Status reviewed

Secondary Information

Protein Function Decapping enzymes.Participate in degradation of mRNAs both in normal mRNA turnover and in nonsense-mediated mRNA decay.
Biochemical Properties Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP.
PTMs Phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SZL6|DCP1B_BOVIN mRNA-decapping enzyme 1B OS=Bos taurus OX=9913 GN=DCP1B PE=2 SV=1 MAVAGGPAGKGRDISLAALRRHDPYISRIVDVASQVALYTFGHRANEWEKTDVEGTLFVY SRSASPKHGFTIMNRLSMENRTEPITKDLDFLLQDPFLLYRNARLSIYGIWFYDKEECQR IAELMKNLTQYEQLKAHHGTGAGAS*145PVSLGSGEGKEADILRMLTKAKDEYTKCKTCSEPK QISSSSAIHDNPNLIKPIPVKPSGSRQQRGPRPGQTSDPEPQHLSLTALFGKQDKAPCQE ATGPPQTLPLQQQQPEKFPMRQGVVRSLS*269YEEPRRPSPPVDKQLCPAIQKLMVRSMDLQP LAELPESRPCTDALRAACAGPAQT*324GSPRSHALAAPGTQKLLQVQSIPGAENRCEPGAPAP ASSATT*366PVSLAQPTRLSSALPPQTPGPRALPRPAPPGPGPGHQPVTGPGEVS*412PRELLRRL QAVQQEQQLPAPGRPALAAKFPTATLSTRARNPLEPWRDPPPSTEQPAPLLQVLS*475PQRIP AAATPPPLMSPLVFAQPSWAPPQERSRAPLPPGNQDPAATPTGLLLPLRTPEPPGTPGSA LSKLQLQEALLHLIQNDDNFLNIIYEAYLFSLTQAAVKKTL
Predicted Disorder Regions 141-152, 171-185, 196-219, 244-270, 307-315, 319-346, 362-382, 406-418, 440-461, 482-533
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Lykke-Andersen J. Identification of a human decapping complex associated with hUpf proteins in nonsense-mediated decay. Mol Cell Biol. 2002 Dec;22(23):8114-21. doi: 10.1128/MCB.22.23.8114-8121.2002. PMID: 12417715; PMCID: PMC134073.