Search by BoMiProt ID - Bomi7223


Primary Information

BoMiProt ID Bomi7223
Protein Name M-phase inducer phosphatase 3/Dual specificity phosphatase Cdc25C
Organism Bos taurus
Uniprot IdA5D7P0
Milk FractionWhey
Ref Sequence Id NP_001091465.1
Aminoacid Length 477
Molecular Weight 53794
Fasta Sequence https://www.uniprot.org/uniprot/A5D7P0.fasta
Gene Name CDC25C
Gene Id 507731
Protein Existence Status reviewed

Secondary Information

Protein Function CDC25C is a cyclin of the specific phosphatase family that activates the cyclin B1/CDK1 complex in cells for entering mitosis and regulates G2/M progression and plays an important role in checkpoint(G2/M progression) protein regulation in case of DNA damage, which can ensure accurate DNA information transmission to the daughter cells.It can promote mitotic cell G2/M transition by triggering cyclin-dependent kinase-1 (CDK1) dephosphorylation to activate the cyclin B1/CDK1 complex
Biochemical Properties Bispecific phosphatase which hydrolyzes Tyr and Ser/Thr phosphate.CDC25C acts on the CDK1 Thr14 and Tyr15 residues, dephosphorylating them, and activating this complex into mitosis.During interphase, CDC25C shuttles from the cytoplasm to the nucleus.14-3-3 and CDC25C can form a complex and localised to the cytoplasm.
PTMs Phosphorylation,Acetylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A5D7P0|MPIP3_BOVIN M-phase inducer phosphatase 3 OS=Bos taurus OX=9913 GN=CDC25C PE=2 SV=1 MSAEFFSSKREEGSLASGPS*20FRSNQRKILNLLLERDAS*38FSISSDLPTT*48PVEKKLFGDS*58AN LS*62ILS*65GGT*68PKRCLDLSNLSSGEMSATQLTASADLDETGHLESTGPEQVRLAGMNYRQHLI KCS*123PAQLFCS*130T*131PNALEHGRRKKDAICGSSANKENDNGNLVENEMKHLGS*169PITTVSKLHKNPELAEDQAEEIS*192DELMEFS*199LEDQEKAKPPLNWSSLYRS*218SS*220LPDSLNSPSLKQVVKFKDSTIPDKLKKKYCSNQKELGKGLGLKKMVSLCDINMTQMLEEDSNQGPLIGDFSKVCALPTVS GKHQDLKYVNPETVAALLSGEFQGLIEKFYIIDCRYPYEYLGGHIQGALNLHSQEELYNF FLKKPIVPWDNQKRIVIVFHCEFSSERGPRMCRSLREEDRTLNQYPALYYPELYILKGGY RDFFPEYMELCEPQSYCPMHHQDHKAELLRCRNQSKAWEGERQLQEQIALLVKDVS*476P
Predicted Disorder Regions 1-20, 82-106, 139-156, 167-225, 236-263
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation of CDC25C on Ser216 and Ser287(binding sites for 14-3-3 protein) at the interphase prevents its activation and promotes cytoplasmic location by binding to 14-3-3 protein.When Ser191 and Ser198 in NES of CDC25C are phosphorylated, it facilitates nuclear translocation of CDC25C.In G2/M progression, activation of CDC25C requires dissociation from 14-3-3 protein and phosphorylation in various sites within the N-terminal domain, such as Thr48, Thr67, Ser122, Thr130, and Ser214.Activated cyclin B1/CDK1 phosphorylates CDC25C at Thr48, Thr67, Thr138, Ser205, and Ser285 to activate it.
Bibliography Liu K, Zheng M, Lu R, Du J, Zhao Q, Li Z, Li Y, Zhang S. The role of CDC25C in cell cycle regulation and clinical cancer therapy: a systematic review. Cancer Cell Int. 2020 Jun 3;20:213. doi: 10.1186/s12935-020-01304-w. PMID: 32518522; PMCID: PMC7268735.