Search by BoMiProt ID - Bomi7213


Primary Information

BoMiProt ID Bomi7213
Protein Name Mothers against decapentaplegic homolog 1/SMAD family member 1
Organism Bos taurus
Uniprot IdQ1JQA2
Milk FractionWhey
Ref Sequence Id NP_001069691.2
Aminoacid Length 465
Molecular Weight 52250
Fasta Sequence https://www.uniprot.org/uniprot/Q1JQA2.fasta
Gene Name SMAD1
Gene Id 540488
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells abomasum
Protein Function Smad1 is one of the transcription factors and also a pivotal intracellular effector of the bone morphogenetic protein (BMP) family of proteins.
PTMs N-Acetylation at Meth, Phosphorylation at Ser, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1JQA2|SMAD1_BOVIN Mothers against decapentaplegic homolog 1 OS=Bos taurus OX=9913 GN=SMAD1 PE=2 SV=1 MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQ PSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEV CINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPN SHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQ PMDTNMMAPSLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT DPSNNKNRFCLGLLSNVNRNST*322IENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC NYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISS*463VS*465
Predicted Disorder Regions 39-47, 140-146, 160-267, 458-462
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation of the C-terminal SVS motif by BMP type 1 receptor kinase activates SMAD1 by promoting dissociation from the receptor and trimerization with SMAD4.Ubiquitinated by SMAD-specific E3 ubiquitin ligase SMURF1, leading to its degradation. Monoubiquitinated, leading to prevent DNA-binding.
Bibliography 1.Hegarty SV, O'Keeffe GW, Sullivan AM. BMP-Smad 1/5/8 signalling in the development of the nervous system. Prog Neurobiol. 2013 Oct;109:28-41. doi: 10.1016/j.pneurobio.2013.07.002. Epub 2013 Jul 24. PMID: 23891815. 2.