Search by BoMiProt ID - Bomi7197


Primary Information

BoMiProt ID Bomi7197
Protein Name MMS19 nucleotide excision repair protein homolog
Organism Bos taurus
Uniprot IdE1BP36
Milk FractionExosomes
Ref Sequence Id NP_001095627.1
Aminoacid Length 1030
Molecular Weight 113112
Fasta Sequence https://www.uniprot.org/uniprot/E1BP36.fasta
Gene Name MMS19
Gene Id 533499
Protein Existence Status reviewed

Secondary Information

Protein Function Key component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into apoproteins specifically involved in DNA metabolism and genomic integrity.Involved in methionine biosynthesis, DNA replication, DNA repair and telomere maintenance.
PTMs Acetylation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|E1BP36|MMS19_BOVIN MMS19 nucleotide excision repair protein homolog OS=Bos taurus OX=9913 GN=MMS19 PE=2 SV=3 MAAAAALEAVAPLGTLWGLVQDFVMGQQEGPADQVAADVKSGSYTVLQVVEALGSSLENP EPRTRARGIQLLSQVLLQCHSLLLEKEVVHLILFYENRLKDHHLVIPSVLQGLRALSLCV TLPPGLAVSVLKAIFQEVHVQSLPQVDRHTVYSIITNFMRAREEELKGLGADFTFGFIQV MDGEKDPRNLLVAFHIVYDLISRDYSLGPFVEELFEVTSCYFPIDFTPPPNDPHGIQRED LILSLRAVLASTPRFAEFLLPLLIEKVDSEILSAKLDSLQTLNACCAVYGQKELKDFLPS LWASIRREVFQTASERVEAEGLAALNSLTACLSRSVLRADAEDLLDSFLSNILQDCRHHL CEPDMKLVWPSAKLLQAAAGASARACDHVTSNVLPLLLEQFHKHSQSNQRRTILEMILGF LKLQQKWSYEDKDERPLSGFKDQLCSLMFMALTDPNTQLQLVGIRTLTVLGAQPDLLSSG DLELAVGHLYRLSFLEEDSQSCRVAALEASGTLATLYPMAFSSHLVPRLAEDLCTEESDL ARADGPTRCSRHPRCLQALSAISTHPSIVKETLPLLLQHLCQMNRGSVSPGTSEVIAVCQ SLQQVAENCQRDPESCWYFHQTAVPCLLALVVQASAPEKEHSVLKKVLLEDEVLATMASV IATATTHLSPDLASQSVAHIVPLFLDGNISFLPENSFSGRFQPFQDGSSGQRRLVALLMA FVCSLPRNVEIPQLNRLMGELLELSCCQSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQL AVDKVEAGLSSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTERLMGLLSDPELGPAAADG FSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVRGFHAAPQDVKPNYLKGLSHVLN RLPKPVLLPELPTLLSLLLEALSCPDSVVQLSTLSCLQPLLLEAPQVMSLHVDTLITKFL NLSASPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKPLDDKKRLVRKEAVSARG EWFLLGS*1027PGS
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Stehling O, Vashisht AA, Mascarenhas J, Jonsson ZO, Sharma T, Netz DJ, Pierik AJ, Wohlschlegel JA, Lill R. MMS19 assembles iron-sulfur proteins required for DNA metabolism and genomic integrity. Science. 2012 Jul 13;337(6091):195-9. doi: 10.1126/science.1219723. Epub 2012 Jun 7. PMID: 22678362; PMCID: PMC3420340.