Search by BoMiProt ID - Bomi7187


Primary Information

BoMiProt ID Bomi7187
Protein Name Mitotic-spindle organizing protein 2/Mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2
Organism Bos taurus
Uniprot IdA5PJV8
Milk FractionWhey
Ref Sequence Id NP_001092674.1
Aminoacid Length 158
Molecular Weight 15891
Fasta Sequence https://www.uniprot.org/uniprot/A5PJV8.fasta
Gene Name MZT2/FAM128/ MOZART2
Gene Id 787548
Protein Existence Status reviewed

Secondary Information

Protein Function Microtubule organization
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A5PJV8|MZT2_BOVIN Mitotic-spindle organizing protein 2 OS=Bos taurus OX=9913 GN=MZT2 PE=2 SV=1 MAAAGAGPGPGPGAPPGLEAALQKLALRRKKVLS*34AEEMELFELAQAAGGAMDPDVFKILV DLLKLNVAPLAVFQMLKSMCAGQRVASDSQDPTAAPLPTPSVPETRGRNKGGGALGGGPA LAERGGRDGPGQRMPRQPSASRLPKGGGPGRS*152PPRSGT
Predicted Disorder Regions 2 disordered segments; (1-49), (80-158)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Wieczorek M, Huang TL, Urnavicius L, Hsia KC, Kapoor TM. MZT Proteins Form Multi-Faceted Structural Modules in the γ-Tubulin Ring Complex. Cell Rep. 2020 Jun 30;31(13):107791. doi: 10.1016/j.celrep.2020.107791. PMID: 32610146; PMCID: PMC7416306.