Search by BoMiProt ID - Bomi7147


Primary Information

BoMiProt ID Bomi7147
Protein Name Mitochondrial import receptor subunit TOM22 homolog
Organism Bos taurus
Uniprot IdA6QPI6
Milk FractionWhey,Exosome,MFGM
Ref Sequence Id NP_001093805.1
Aminoacid Length 140
Molecular Weight 15292
Fasta Sequence https://www.uniprot.org/uniprot/A6QPI6.fasta
Gene Name TOMM22
Gene Id 510780
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells Mitochondrial outer membrane
Protein Function Central receptor component of the translocase of the outer membrane of mitochondria (TOM complex) responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with the peripheral receptor TOM20 functions as the transit peptide receptor and facilitates the movement of preproteins into the translocation pore.Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases.
Biochemical Properties orms part of the preprotein translocase complex of the outer mitochondrial membrane (TOM complex) which consists of at least 7 different proteins (TOMM5, TOMM6, TOMM7, TOMM20, TOMM22, TOMM40 and TOMM70).The N-terminal domain (residues 1-60) is important for binding to the unfolded mature imported proteins.Residues (47-69) of the cytoplasmic domain interacts with TOMM20 while the C-terminal segment (residues 61-80) binds presequence of preproteins.Requires the transmembrane domain (TMD), a short segment (the import sequence) in the cytoplasmic domain localizing separately from the TMD and the C-tail signal in the C-terminal domain for efficient targeting and integration into the TOM complex .
PTMs Phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QPI6|TOM22_BOVIN Mitochondrial import receptor subunit TOM22 homolog OS=Bos taurus OX=9913 GN=TOMM22 PE=2 SV=1 MAAAAAGPGAPLS*13ADELLPKGDAEKPEEELEEEDDEELDET*41LS*43ERLWGLTEMFPERVRSA AGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLG PNTGLSGGMPGALPSLPGKI
Predicted Disorder Regions 2 predicted disordered segments;(1-55), (107-140)
DisProt Annotation
TM Helix Prediction 1TMH; 81-99