Primary Information |
---|
BoMiProt ID | Bomi7147 |
---|
Protein Name | Mitochondrial import receptor subunit TOM22 homolog |
---|
Organism | Bos taurus |
---|
Uniprot Id | A6QPI6 |
---|
Milk Fraction | Whey,Exosome,MFGM |
---|
Ref Sequence Id | NP_001093805.1 |
---|
Aminoacid Length | 140 |
---|
Molecular Weight | 15292 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/A6QPI6.fasta |
---|
Gene Name | TOMM22 |
---|
Gene Id | 510780 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | Mitochondrial outer membrane |
---|
Protein Function | Central receptor component of the translocase of the outer membrane of mitochondria (TOM complex) responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with the peripheral receptor TOM20 functions as the transit peptide receptor and facilitates the movement of preproteins into the translocation pore.Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases. |
---|
Biochemical Properties | orms part of the preprotein translocase complex of the outer mitochondrial membrane (TOM complex) which consists of at least 7 different proteins (TOMM5, TOMM6, TOMM7, TOMM20, TOMM22, TOMM40 and TOMM70).The N-terminal domain (residues 1-60) is important for binding to the unfolded mature imported proteins.Residues (47-69) of the cytoplasmic domain interacts with TOMM20 while the C-terminal segment (residues 61-80) binds presequence of preproteins.Requires the transmembrane domain (TMD), a short segment (the import sequence) in the cytoplasmic domain localizing separately from the TMD and the C-tail signal in the C-terminal domain for efficient targeting and integration into the TOM complex . |
---|
PTMs | Phosphorylation on Ser and Thr |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A6QPI6|TOM22_BOVIN Mitochondrial import receptor subunit TOM22 homolog OS=Bos taurus OX=9913 GN=TOMM22 PE=2 SV=1
MAAAAAGPGAPLS*13ADELLPKGDAEKPEEELEEEDDEELDET*41LS*43ERLWGLTEMFPERVRSA
AGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLG
PNTGLSGGMPGALPSLPGKI
|
---|
Predicted Disorder Regions | 2 predicted disordered segments;(1-55), (107-140) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | 1TMH; 81-99 |