Search by BoMiProt ID - Bomi7137


Primary Information

BoMiProt ID Bomi7137
Protein Name Mitochondrial 2-oxoglutarate/malate carrier protein/Solute carrier family 25 member 11
Organism Bos taurus
Uniprot IdP22292
Milk FractionWhey
Ref Sequence Id NP_777096.1
Aminoacid Length 314
Molecular Weight 34172
Fasta Sequence https://www.uniprot.org/uniprot/P22292.fasta
Gene Name SLC25A11/SLC20A4
Gene Id 282523
Protein Existence Status reviewed

Secondary Information

Protein Function The transport of 2-oxoglutarate across the mitochondrial membrane is specifically limited to the 2-oxoglutarate-malate carrier (OMC) protein
Biochemical Properties Although labeling of cytosolic glutamate does occur when there is little transport of NADH across the mitochondrial membrane, because of the reversible nature of OMC, efflux of 2-oxoglutarate from mitochondria via OMC is stimulated during the recruitment of net forward flux through the malate/aspartate shuttle
PTMs Acetylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P22292|M2OM_BOVIN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Bos taurus OX=9913 GN=SLC25A11 PE=1 SV=3 MAATAS*6PGASGMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTRE YKTSFHALISILRAEGLRGIYTGLSAGLLRQATYTTTRLGIY*102TVLFERLTGADGTPPGFL LKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPVDQRRGYKNVFNALFRIVQEEGVPTL WRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPV DIVKTRIQNMRMIDGKPEYKNGLDVLVKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL EQMNKAYKRLFLSG
Predicted Disorder Regions (1-19)
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments detection of glutamate labeling from intact systems, organs, and whole animals has often been interpreted directly as TCA cycle flux in isotope studies
Bibliography 1.J. L. Griffin, J. M. O'Donnell, L. T. White, R. J. Hajjar and E. D. Lewandowski Am J Physiol Cell Physiol 279:1704-1709, 2000. 2.