Search by BoMiProt ID - Bomi7126


Primary Information

BoMiProt ID Bomi7126
Protein Name Microtubule-associated protein 1S/MAP-1S
Organism Bos taurus
Uniprot IdA6QQ70
Milk FractionWhey
Ref Sequence Id NP_001095584.1
Aminoacid Length 1066
Molecular Weight 112472
Fasta Sequence https://www.uniprot.org/uniprot/A6QQ70.fasta
Gene Name MAP1S
Gene Id 527829
Protein Existence Status reviewed

Secondary Information

Protein Function it bridges autophagic components with microtubules and mitochondria to affect autophagosomal biogenesis and degradation
Biochemical Properties The ubiquitously distributed MAP1S is a homologue of the exclusively neuronal distributed microtubule-associated protein 1A and 1B (MAP1A/B). MAP1A/B (LC3), a homologue of yeast autophagy-related gene 8 (ATG8), and recruited it to stable microtubules in a MAP1S and LC3 isoform-dependent mode.
PTMs Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QQ70|MAP1S_BOVIN Microtubule-associated protein 1S OS=Bos taurus OX=9913 GN=MAP1S PE=2 SV=1 MAATVAGSGAAEVPSSLLLVVGGECGCRGLLAYVLEELERGIRSWDIDPGVCSLDEQLKV FVSRHSATFSSIVKGQRSLHHRGDTLETLVLLNPSDKSLCDELRNLLLDTASHKLLVLAG PCLEETGELLLQTGGFSPRHFLQVLGDKEIRDLLASTPPPAAPPKLTITCPTFGDWARLA PEVPGLQGVLHLRLNPPVQLPASEGLREFLEYVAESLEPPSPFELLEPPASVGLLRLARP CCYIFPGGLGDAAFFAVNGFTVLVNGGSNPKSSFWKLVRHLDRVDAVLVTHAGADSLPGL NSLLRRKLAERDEAAAGGGS*320GDDRLRRLISPNLGVVFLNARAAASRLVRGEDEAELALSL LSQLGITPVPLNRGPLPAEPTVLFQKMGVGRLDMYVLHPPSAATTDHTLASVCALLVWHP AGPSEKVVRVLFPGCTPPARLLDGLVHLQHLGFLREPVVTPQDMAGPRRAES*472KESVASRD SLRREGRTTVPSRPTQERPGVARKDSPRTEAPRRAEKEARPSREVKKDPRPSAPRTQPRE VRRAASAVVSGKNVGAQVAPKTRRAPNTPRPGVPPAENGPRS*582PPSFRSGEASPPTEACSS PAPQLVATPSQESSLDLGLSPAGEEGGSLEEKTLELLLAASTPEPCT*647PS*649PAGAQQGPTES*660 SGPLS*665LS*667PLRGGEPGPDASPTVTTPSLPAEVGSPHSTEVDESLSVSFEQVLPPPAAAASE AGLSLPLCGPRVRRSAS*737PHDVDLCLVSPCEFEHRKAVPMAPAPVS*765PGSSNDSSARSQERA GAPGGAEETPPTSVSESLPTLSDSDPLPAAPGTADS*816DEDTEGFGVPRRDPLPDPLKIPPP LPTPPSICMVDPEMLPPEQARLKGGGSRTRKPLTRPSSGTTPPKATPVTAAKIKGLASGD RASRPLSARSEPSDKGNRASLSRKPSVPKTTTRGPSGSAGSRSGGSAAPPGSPVYLDLAY LPSGGSARLVDEEFFRRVRALCYVISGQDQHKEEGMRAVLDALLAGKQQWDRQLQVTLIP TFDSVAMHEWYEETHTRHQALGITVLGSNSTVSMQDEAFPACKVEF
Predicted Disorder Regions 522-534, 575-724, 749-841, 875-880, 909-951
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments MAP1S may play a general role in autophagy regulation in all tissues
Bibliography 1.Xie R, Nguyen S, McKeehan K, Wang F, McKeehan WL, Liu L. Microtubule-associated protein 1S (MAP1S) bridges autophagic components with microtubules and mitochondria to affect autophagosomal biogenesis and degradation. J Biol Chem. 2011 Mar 25;286(12):10367-77. doi: 10.1074/jbc.M110.206532. Epub 2011 Jan 24. PMID: 21262964; PMCID: PMC3060490.