Search by BoMiProt ID - Bomi7109


Primary Information

BoMiProt ID Bomi7109
Protein Name Microprocessor complex subunit DGCR8/DiGeorge syndrome critical region 8 homolog
Organism Bos taurus
Uniprot IdA6QR44
Milk Fractionwhey
Ref Sequence Id NP_001094674.1
Aminoacid Length 760
Molecular Weight 84383
Fasta Sequence https://www.uniprot.org/uniprot/A6QR44.fasta
Gene Name DGCR8
Gene Id 540254
Protein Existence Status Reviewed

Secondary Information

Protein Function Component of the microprocessor complex that acts as a RNA- and heme-binding protein that is involved in the initial step of microRNA (miRNA) biogenesis. Involved in the silencing of embryonic stem cell self-renewal
Biochemical Properties DGCR8 possesses MAPK docking motifs that match both of the recently structurally defined motifs that are specific for JNK and ERK/p38 kinases.All 23 DGCR8 phosphosites in the N terminus,is required for nuclear localization and for the ability of DGCR8 to homodimerize.
Significance in milk involved with biological processes in response to heat stress effects
PTMs Phosphorylation,Ubl conjugation,isopeptide bond formation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QR44|DGCR8_BOVIN Microprocessor complex subunit DGCR8 OS=Bos taurus OX=9913 GN=DGCR8 PE=2 SV=1 METCGSPSPLPREPAGGVAMEDRARPLRALPRGQS*35PPPPLQTSSDAEVMDVGSGGDGQAE PPAEDPLNFYGASLLSKGSSSKARLLVDPNCS*92GHS*95PRTARHAPAVRKFSPDLKLLKDVKI SVSFTESCRSEDRKVLYTGAERDVRAECGLALSPVIGDVHAGPFGGSVGNGVGAGGESAG KRDEEHELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFSYE DDFDNDVDALLEEGLCAPKKRRMEEKYGGDS*271DHPS*275DGET*279SVQPMMTKIKTVLKSRGRPPT EPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHGPPLTSIPCLHYRKMKD SEERERAAGIAPPEPELPPDEPDPLGTDAGPPDEKDPLGAEAAPGALGQVKAKVEVCKDE SVDLEEFRNYLEKRFDFEQVTVKKFRTWAERRQFNREMKRKQAESERPILPANQKLITLS VQDAPTKKEFVINPNGKSEVCILHEYMQRVLKVRPVYSFFECENPSEPFGASVTIDGVTY GSGTASSKKLAKNKAARATLEILIPDFVKQTSEEKPRDSEELEYFNHISIEDSRVYELTS KAGLLSPYQILHECLKRNHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGK QLASQKILQLLHPHVKNWGSLLRMYGRESSKMVKQETSDKSVIELQQFARKNKPNLHILS KLQEEMRRLAEEREETRKKPKMSIVASAQPGGEPLCTVDV
Predicted Disorder Regions 19-53, 77-85, 169-202, 378-396, 747-749
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs DGCR8 possesses MAPK docking motifs that match both of the recently structurally defined motifs that are specific for JNK and ERK/p38 kinases.DGCR8 can be phosphorylated by mitogenic ERK/MAPK, indicating that DGCR8 phosphorylation may respond to and integrate extracellular cues.
Additional Comments DGCR8 function is clearly important, as it is essential for viability in mice and DGCR8-knockout embryonic stem cells show a proliferation defect.DGCR8 deficiency in the brain has also been suggested to cause behavioral and neuronal defects associated with the 22q11.2 deletion syndrome known as DiGeorge syndrome.
Bibliography 1.Herbert, K. M., Pimienta, G., DeGregorio, S. J., Alexandrov, A., & Steitz, J. A. (2013). Phosphorylation of DGCR8 increases its intracellular stability and induces a progrowth miRNA profile. Cell reports, 5(4), 1070–1081. https://doi.org/10.1016/j.celrep.2013.10.017 2.Landthaler, M., Yalcin, A., & Tuschl, T. (2004). The human DiGeorge syndrome critical region gene 8 and Its D. melanogaster homolog are required for miRNA biogenesis. Current biology : CB, 14(23), 2162–2167. https://doi.org/10.1016/j.cub.2004.11.001