Search by BoMiProt ID - Bomi7107


Primary Information

BoMiProt ID Bomi7107
Protein Name MICOS complex subunit MIC25/Coiled-coil-helix-coiled-coil-helix domain-containing protein 6
Organism Bos taurus
Uniprot IdQ32L35
Milk FractionWhey
Ref Sequence Id NP_001069870.1
Aminoacid Length 236
Molecular Weight 26439
Fasta Sequence https://www.uniprot.org/uniprot/Q32L35.fasta
Gene Name CHCHD6/MIC25
Gene Id 615934
Protein Existence Status reviewed

Secondary Information

Protein Function  controlling mitochondrial cristae structures.critical for maintaining the mitochondrial cristae morphology, ATP production, and oxygen consumption.
Biochemical Properties a coiled coil helix-coiled coil helix domain at its C-terminal end and predominantly localizes to mitochondrial inner membrane.contain hydrophobic transmembrane regions. contain hydrophobic transmembrane regions.  
PTMs Lipidation,Disulfide bond formation,N-myristoylation,Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32L35|MIC25_BOVIN MICOS complex subunit MIC25 OS=Bos taurus OX=9913 GN=CHCHD6 PE=2 SV=1 MGSAESREGRRAS*13FGMDEEERVRVLQGIRLS*31ENVVNRMKEPGQPSRVGLLAPPAAALGPS GGREKDSKPPRPDCGSGRGPPRVQVDPLERCDWEQAVLQDELVRVATTEREAAASPRSVT LRRGEGGVDQEKQRLAQRARELESQEEELRCRDAFYKEQLGRLERQNLEAYRLSSQQFHE AATKIEGAIKPRRVEPVCSGLQAQILRCYRDRLQEVLLCADLVRAYQHCVSSAHKG
Predicted Disorder Regions 1-141, 227-236
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments CHCHD6 depletion also leads to reductions in cell growth, ATP production, and oxygen consumption.through its C-terminal end strongly interacts with the mitochondrial inner membrane protein mitofilin, which is known to also control mitochondrial cristae morphology.
Bibliography An J, Shi J, He Q, Lui K, Liu Y, Huang Y, Sheikh MS. CHCM1/CHCHD6, novel mitochondrial protein linked to regulation of mitofilin and mitochondrial cristae morphology. J Biol Chem. 2012 Mar 2;287(10):7411-26. doi: 10.1074/jbc.M111.277103. Epub 2012 Jan 6. PMID: 22228767; PMCID: PMC3293568.