Search by BoMiProt ID - Bomi7106


Primary Information

BoMiProt ID Bomi7106
Protein Name MICOS complex subunit MIC19/Coiled-coil-helix-coiled-coil-helix domain-containing protein 3
Organism Bos taurus
Uniprot IdQ5E9D3
Milk FractionWhey
Ref Sequence Id NP_001030552.1
Aminoacid Length 227
Molecular Weight 26100
Fasta Sequence https://www.uniprot.org/uniprot/Q5E9D3.fasta
Gene Name CHCHD3
Gene Id 616477
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells  corpus luteum 
Protein Function Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. 
PTMs N6-Acetylation at Lys, Disulfide bond formation, Lipoylation, Myristoylation, Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5E9D3|MIC19_BOVIN MICOS complex subunit MIC19 OS=Bos taurus OX=9913 GN=CHCHD3 PE=2 SV=1 MGGTASTRRVTFEADENENITVVKGIRLS*29ENVIDRMKETSPSGPKSQRY*49S*50GTYGAS*56VS*58DE ELKRRVAEELALEQAKKESENQKRLKQSKELDAEKAFANEQLTRAILRERISNEEERAKA KHLAKQLEEKDRVIKKQDAFYKEQLARLEERSSEFYKVTTEQYQKAAEEVEAKFKRYEYH PVCADLQAQILQCYRQNTQQTLSCSALASQYMRCVNQAKQSTLEKGG
Predicted Disorder Regions 1-15, 29-107
DisProt Annotation
TM Helix Prediction No TM helices