Search by BoMiProt ID - Bomi7047


Primary Information

BoMiProt ID Bomi7047
Protein Name Methionine synthase reductase(MSR)/Aquacobalamin reductase(AqCbl reductase)
Organism Bos taurus
Uniprot IdQ4JIJ2
Milk FractionWhey,MFGM
Ref Sequence Id NP_001025470.1
Aminoacid Length 695
Molecular Weight 77163
Fasta Sequence https://www.uniprot.org/uniprot/Q4JIJ2.fasta
Gene Name MTRR
Gene Id 507991
Protein Existence Status reviewed

Secondary Information

Protein Function Methionine synthase reductase (MTRR) plays a major role in hyperhomocysteinemia, a risk factor related to the occurrence of congenital heart defects (CHDs).
Biochemical Properties Methionine synthase reductase (MTRR) is required for the reductive methylation of cobalamin, which is the functional cofactorial form of methionine synthase (MS) in the remethylation of homocysteine to methionine. 
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q4JIJ2|MTRR_BOVIN Methionine synthase reductase OS=Bos taurus OX=9913 GN=MTRR PE=2 SV=1 MRRFLLLYATQRGQAKAIAEEISEKAVTYGFSADLHCISESDKYDLKTETAPLVMVVSTT GNGDPPDTARKFVKAIKDKTLPPDFLAHLRYGLLGLGDSEYTYFCNGGKVIDKRLQELGA QRFYDTGHADDCVGLELVVEPWINGLWAALEKHFLSNRGREDTSETLTMAS*171HASRDAVTP ELLHVES*187QVGLLKLDDSGGKAAKVLEQNAVNSNQSSTLIVDFEASLTHSVPPLSQASLNI PSLPPEYLEVHLEEALGQEESHASVSLVDPVFHVPVSKAVQLTTNDAIKTTLLIELDISK TDFSYQPGDAFNVICPNSDSEVQFLLQRLQLADRREHHVAVTIKADTRKKGAALPQHVPE RCSLQFLLTWCLEIRAVPKKAFLRALADHTGDSAERRRLQELCSRQGAADYTRFVREAGA CLSDLLRAFPSCQPPLGLLLEHLPKLQPRPYSCASSSLFHPGKLHFIFNIVEFLSNTTEV ILRRGVCTGWLATLVESILQPYMCANHVDGKKALAPKISISPRTTNSFHLPDDPSVPIIM VGPGAGVAPFIGFLQHREKLQEQHPGGHFGATWLFFGCRHKERDYLFRDELRHFLKCGVL THLEVSFSRDVAVGEEEGPAKYVQDSLQRHSKQVAGVLLQDSGYVYVCGDAKNMAKDVHD ALVEIISRETGVEKLEAMKTLATLKEEKRYLQDIW
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Methionine synthase reductase A66G polymorphism is associated with decreased risk of leukemia in a Caucasian population and in children, especially for ALL.
Bibliography 1.Fang DH, Ji Q, Fan CH, An Q, Li J. Methionine synthase reductase A66G polymorphism and leukemia risk: evidence from published studies. Leuk Lymphoma. 2014 Aug;55(8):1910-4. doi: 10.3109/10428194.2013.867492. Epub 2014 Jan 24. PMID: 24261678. 2.Yu D, Yang L, Shen S, Fan C, Zhang W, Mo X. Association between methionine synthase reductase A66G polymorphism and the risk of congenital heart defects: evidence from eight case-control studies. Pediatr Cardiol. 2014 Oct;35(7):1091-8. doi: 10.1007/s00246-014-0948-9. Epub 2014 Jun 10. PMID: 24913415.