Search by BoMiProt ID - Bomi7046


Primary Information

BoMiProt ID Bomi7046
Protein Name Methionine aminopeptidase 2/MAP 2/MetAP 2/Initiation factor 2-associated 67 kDa glycoprotein/p67/p67eIF2/Peptidase M
Organism Bos taurus
Uniprot IdQ3ZC89
Milk Fractionwhey
Ref Sequence Id NP_001035583.1
Aminoacid Length 477
Molecular Weight 52812
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZC89.fasta
Gene Name METAP2
Gene Id 404150
Protein Existence Status Reviewed

Secondary Information

Protein Function It removes the N-terminal methionine from nascent proteins during translation.
Biochemical Properties The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged
PTMs Glycosylation, Acetylation and phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZC89|MAP2_BOVIN Methionine aminopeptidase 2 OS=Bos taurus OX=9913 GN=METAP2 PE=2 SV=1 MAGVEEAASCGSHLNGDLDPDEREEGAASTAEEAAKKKKRKKKKS*45KGAATGQQEPDKEAG AS*62*62VDEVTRQLERQALEEKEKDDDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPIC DLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVRK YVMSWIKPGMTMIEICEKMEDCSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTTV LQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDTLLKAVKDATNTGIKCAGIDVRLCDVG EAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGPYRIHAGKTVPIVKGGEATRMEEGEVY AIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWLD RLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY
Predicted Disorder Regions (1-120)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs O-glycosylation is required for EIF2S1 binding
Bibliography Goya Grocin, A., Kallemeijn, W. W., & Tate, E. W. (2021). Targeting methionine aminopeptidase 2 in cancer, obesity, and autoimmunity. Trends in pharmacological sciences, 42(10), 870–882. https://doi.org/10.1016/j.tips.2021.07.004