Primary Information |
---|
BoMiProt ID | Bomi7038 |
---|
Protein Name | Metalloproteinase inhibitor 3 |
---|
Organism | Bos taurus |
---|
Uniprot Id | P79121 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_776898.2 |
---|
Aminoacid Length | 211 |
---|
Molecular Weight | 24197 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/P79121.fasta |
---|
Gene Name | TIMP3 |
---|
Gene Id | 282094 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. |
---|
Biochemical Properties | Interacts with EFEMP1.Human and mouse TIMP3 protein precursor is composed of 211 amino acids with a secretion signal peptide (1−23 aa) followed by the mature TIMP3 protein sequence.The mature TIMP3 protein is about 24 kDa (Figure 1), and has an N-linked glycosylation site (Asn184) near the carboxyl terminus, while the size of the glycosylated TIMP3 is about 27 kDa . The secondary structure of TIMP3 is composed of 6 loops stabilized by 6 disulfide bonds formed by 12 conserved cysteine residues. |
---|
Significance in milk | degradation of the blood-milk barrier,may be a useful marker for early mastitis diagnosis |
---|
PTMs | N linked glycosylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P79121|TIMP3_BOVIN Metalloproteinase inhibitor 3 OS=Bos taurus OX=9913 GN=TIMP3 PE=2 SV=1
MTPWLGLVVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLLKEGPFGTM
VYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNF
VERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMFSNFGYPGYQSK
HYACIRQKGGYCSWYRGWAPPDKSIIN*207ATDP
|
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Bibliography | Fan D, Kassiri Z. Biology of Tissue Inhibitor of Metalloproteinase 3 (TIMP3), and Its Therapeutic Implications in Cardiovascular Pathology. Front Physiol. 2020 Jun 16;11:661. doi: 10.3389/fphys.2020.00661. PMID: 32612540; PMCID: PMC7308558. |