Search by BoMiProt ID - Bomi7038


Primary Information

BoMiProt ID Bomi7038
Protein Name Metalloproteinase inhibitor 3
Organism Bos taurus
Uniprot IdP79121
Milk FractionWhey
Ref Sequence Id NP_776898.2
Aminoacid Length 211
Molecular Weight 24197
Fasta Sequence https://www.uniprot.org/uniprot/P79121.fasta
Gene Name TIMP3
Gene Id 282094
Protein Existence Status reviewed

Secondary Information

Protein Function Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli.
Biochemical Properties Interacts with EFEMP1.Human and mouse TIMP3 protein precursor is composed of 211 amino acids with a secretion signal peptide (1−23 aa) followed by the mature TIMP3 protein sequence.The mature TIMP3 protein is about 24 kDa (Figure 1), and has an N-linked glycosylation site (Asn184) near the carboxyl terminus, while the size of the glycosylated TIMP3 is about 27 kDa . The secondary structure of TIMP3 is composed of 6 loops stabilized by 6 disulfide bonds formed by 12 conserved cysteine residues.
Significance in milk degradation of the blood-milk barrier,may be a useful marker for early mastitis diagnosis
PTMs N linked glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P79121|TIMP3_BOVIN Metalloproteinase inhibitor 3 OS=Bos taurus OX=9913 GN=TIMP3 PE=2 SV=1 MTPWLGLVVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLLKEGPFGTM VYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNF VERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMFSNFGYPGYQSK HYACIRQKGGYCSWYRGWAPPDKSIIN*207ATDP
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Fan D, Kassiri Z. Biology of Tissue Inhibitor of Metalloproteinase 3 (TIMP3), and Its Therapeutic Implications in Cardiovascular Pathology. Front Physiol. 2020 Jun 16;11:661. doi: 10.3389/fphys.2020.00661. PMID: 32612540; PMCID: PMC7308558.