Search by BoMiProt ID - Bomi7028


Primary Information

BoMiProt ID Bomi7028
Protein Name Mesoderm induction early response protein 2/Mi-er2
Organism Bos taurus
Uniprot IdA5PJX4
Milk FractionWhey
Ref Sequence Id NP_001092496.1
Aminoacid Length 561
Molecular Weight 61299
Fasta Sequence https://www.uniprot.org/uniprot/A5PJX4.fasta
Gene Name MIER2
Gene Id 523726
Protein Existence Status reviewed

Secondary Information

Protein Function functions as a transcriptional repressor through its ability to recruit HDAC1/2 activity
Biochemical Properties Enables RNA polymerase II-specific DNA-binding transcription factor binding
PTMs Phosphorylation at serine
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A5PJX4|MIER2_BOVIN Mesoderm induction early response protein 2 OS=Bos taurus OX=9913 GN=MIER2 PE=2 SV=1 MAEASSLERQS*11PGAASCLPHSLCPGEPNLQTTAVVSMGSADHQFHLAEILSQNYGVREEH EGAAPGPEKPEEELEKDFVSQSSDMPLDELLALYGYETSDPISERESEGSDTAAHLPDMT LDKDQIAKDLLSGEEEEETQSSADDLTPSVTSHEASDLFPSQSGSCFLADADKEPGSSSS SDAEEDPLPANKCKKEIMVGPQFQADLSNLHSNRHGEKIYENEDQLLWDPNILPEREVEE FLYRAVKRRWHEMAGSQLPEGEAVKDSEQALYELVKCNFNAEEALRRLRFNVKVIRDGLC AWSEEERRNFEHGFRVHGKNFHLIQANKVRTRSVGECVEYYYLWKKSERYDYFSQQTRLG RRKYGPSGNTDADQDLEGSDPDGPGRPRSSPPLPLPAAAHGPGPEHDRLAQMHTEPLSMG SSMSRSLGEPGEALDVPPSSEPGPRLFPPLDEPSALPSSRRPPALAEPAFFPPATAAPEP GASPRLAVDLTLPEELPLVSSHEDTDGEPEETVGPPQVALSVAEFGLIGIGDVNPFLASH PACPASGLHSEPLSHCNVMTC
Predicted Disorder Regions 1-28, 52-188, 360-515
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Human MI-ER1 alpha and beta function as transcriptional repressors by recruitment of histone deacetylase 1 to their conserved ELM2 domain. Ding Z, Gillespie LL, Paterno GD. Mol. Cell. Biol. 23, 250-8, (2003). View articlePMID: 12482978